SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003328 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003328
Domain Number 1 Region: 18-98
Classification Level Classification E-value
Superfamily CAD & PB1 domains 5.89e-36
Family PB1 domain 0.00015
Further Details:      
 
Domain Number 2 Region: 132-249
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-22
Family PDZ domain 0.0000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003328   Gene: ENSONIG00000002657   Transcript: ENSONIT00000003329
Sequence length 452
Comment pep:novel scaffold:Orenil1.0:GL831161.1:3516729:3552679:1 gene:ENSONIG00000002657 transcript:ENSONIT00000003329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRSFNKSQPLRNPNCNAVEVKSKYGAEFRRFSVDRVKPGKFEEFYKLILHIHRIANMEV
MIGYADVHGDLLPINNDDNFVKAVSTAHPLLRIFIQRQEEMDYTNFASNTITRKKKPVVA
LRNDVNRKRPHIRIGMPQDFRPVSSIIDVDILPESHRRVRLYRHGSDKPLGFYIRDGVSV
RVTSHGLEKVPGIFISRLVPGGLAESTGLLAVNDEVLEVNGIEVTGKSLDQVTDMMIANS
HNLIVTVKPVNQRNNVVRSSRISGSSGQSSDSNGSTGHMYVNTGGMPPSGAHGYQDDLES
DEDNDVVIEKNIKRPSQRSNASLASSASRTQHQNPTTTSGSAAPPSPPTRPLSVVSTASF
HSQQSLNGGSHHHQHSSLSYQFHKDLNLQHNPHQQSLHSHQPHAQLHHTSNPALRHSNGS
LHKILSSLKTDPRNSLALPRGGVEEDGTVITL
Download sequence
Identical sequences I3J388
ENSONIP00000003328 ENSONIP00000003328 XP_003444137.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]