SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003361 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003361
Domain Number 1 Region: 4-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.67e-16
Family Ubiquitin-related 0.00046
Further Details:      
 
Domain Number 2 Region: 336-380
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000488
Family UBA domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003361   Gene: ENSONIG00000002684   Transcript: ENSONIT00000003362
Sequence length 383
Comment pep:novel scaffold:Orenil1.0:GL831133.1:2396705:2401789:1 gene:ENSONIG00000002684 transcript:ENSONIT00000003362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KQEEMASSEWNLSLKLVDQPKSIFHFPEMMPGDVPPGGYRVATLKQLVAAQFPDSIPDPE
LIEFIHCGRKLKDDLTLDACGIQPGSTLHILKKTWPEPESSPEPVNRVTAAREFRVFHAA
LHSLSSAYRDSVYKMLTNKESLDQIIVATPGLRSDPVALGVLQDKDLFVQFTDPNMLDGL
ISSHPALVNAIILVLHSVAGSMPAQSSASSSRNVSASSYSDMPGGFMFEGMSDDEDEFQS
SSPAGPSNRGGVSAGMRPVSLSHSGATGPRPITQSELATALALASTPDSSAVTPTTSSQS
DPSSGIAPMPAGTPVSNDLFSQALQQALQATNMSALQGRWQSQMQQLRDMGIQDEELMLR
ALQATDGDIQAALELIFAGGQGL
Download sequence
Identical sequences I3J3C1
ENSONIP00000003361 ENSONIP00000003361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]