SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003482 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003482
Domain Number 1 Region: 1532-1640
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-35
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 2 Region: 664-773
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-33
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 3 Region: 832-947
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-33
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 
Domain Number 4 Region: 1883-1992
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-32
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 5 Region: 185-289
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-31
Family Spermadhesin, CUB domain 0.00089
Further Details:      
 
Domain Number 6 Region: 2055-2163
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-31
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 
Domain Number 7 Region: 2222-2340
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-31
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 8 Region: 8-114
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-30
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 9 Region: 1352-1468
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-29
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 10 Region: 2409-2512
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-28
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 11 Region: 492-603
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-28
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 12 Region: 1185-1294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-27
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 13 Region: 1011-1120
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-25
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 14 Region: 1706-1815
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-22
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 15 Region: 3116-3187
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.7e-20
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 16 Region: 3000-3068
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.56e-19
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 17 Region: 3176-3245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.07e-19
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 18 Region: 2761-2829
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.62e-18
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 19 Region: 2818-2886
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.37e-18
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 20 Region: 3057-3127
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.87e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 21 Region: 2877-2943
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.62e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 22 Region: 2932-2993
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.4e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 23 Region: 2513-2586
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000361
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 24 Region: 429-500
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000389
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 25 Region: 3296-3363
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000089
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 26 Region: 2168-2236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000101
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 27 Region: 2702-2765
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000121
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 28 Region: 1472-1542
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000229
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 29 Region: 2575-2642
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000243
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 30 Region: 1645-1710
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000526
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 31 Region: 1822-1887
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000742
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 32 Region: 1996-2058
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000751
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 33 Region: 607-669
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000117
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 34 Region: 953-1013
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000236
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 35 Region: 120-184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000297
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 36 Region: 1127-1189
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000364
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 37 Region: 1298-1360
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000796
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 38 Region: 3228-3290
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000104
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 39 Region: 2650-2713
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000124
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 40 Region: 778-847
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 41 Region: 3355-3413
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000167
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 42 Region: 2339-2404
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000944
Family Complement control module/SCR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003482   Gene: ENSONIG00000002776   Transcript: ENSONIT00000003483
Sequence length 3658
Comment pep:novel scaffold:Orenil1.0:GL831161.1:4217217:4495068:-1 gene:ENSONIG00000002776 transcript:ENSONIT00000003483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSGFIYTCGGTLKGRNGSIESPGFPYGYPNGANCTWVIVGEEGSRIQLIFLSFAIEEEYD
FLSLYDGHPHPANFRTRLTGFQVPPPVTSTGNVFSLRLTSDFAVSAHGFKLNYEELHSSS
CGNPGVPPKAVLSGGGRFAVGDSVRYSCVPGYVLDGHATLTCITNAGNAAVWDFPAPICR
AEDTCGGTVRGGSGVVTSPGYPGNYGNQADCTWILLAEPGDTISVIFTDFQTEEKYDYLE
VEGSEPPTIWLSGTNVPSPIVSNKNWLRLHFVTDGNHRYRGFSAHYQVFSPLGMVNTVGQ
RWGHVCDCGSSWSSPHPPPLLSVNNPNMVKCQKEKRQWRIHYEALGQVSVLINTPEAKAE
RKWVGTHKTEAKAQSSVQQHRIKKSILFSSAVKRSVDFKSRGVKLFPGKDSSNKFSILNE
GGVRQASNSCPDPGEPENGKRHGNDFSIGSVVHFSCGEDYVLQGSKSISCQRVAEVFAAW
SDHRPVCKVKTCGSNLQGPSGTFTSPNFPIQYENNAQCVWIISASNPNKVIQINFEEFDL
EIAYDTLTIGDGGEVGDPTTILQVLSGSFVPDLIVSMTHQMWLHLQSDESVGSIGFKINY
KEIDKESCGDPGTPLYGIREGDNFSNGGILRFECQFGFELIGEKTISCQDNNQWSANIPI
CIFPCMSNFTAPSGTVLSPDYPEGYGNNMNCVWLIQSDPGSRIHLAFNDFDLEAPYDSLT
VKDGETNDATVIGRFSGAESPSHLTSNTNTLRLEFQADHSMSGRGFNITYSTFGHNECPD
PGIPINARRFGDSFQLGSSISVVCEDGFIKTQGTETISCQLERGKVMWSGPIPKCEAPCG
GHYSAPSGVILSPGWPGYYKDSLNCEWVIEAEPGRAIKITFDRFQTELGYDFLEIHDGPN
LLSPLVGSFNGTQVPQFLFSSSNFLYLLFTTDNSRSNAGFKILYESVTVDSYSCLDPGIP
VNGIRYGQDFSIGSTVSFGCDSGYRLSHEEPLVCEKNHWWSHPLPTCDALCGGDVRGPWG
TILSPGYPDSYPSSLNCTWTVEVSHGKGVQFQFNSFHLEDQHDYLLVTENGSFLQPLARL
TGNELPSNINAGLYGNFKAQLRFISDFSISYEGFNITFSAEYTLEPCEDPGMPRFGRRNG
YSFGVGDTLSFSCNMGYRLEGSPELICLGGGRRMWSAPLPRCVAECGSSVINNEGILLSP
NYPMNYDNNHECIYSIQVQAGKGINISARTFHLAQGDILKIYDGKDNTAHVLGAFTGSSM
LGLTLISTSNHLWLEFYSDAENTGEGFKLVYSSFELSHCEDPGVPQFGFKVNDQGHFSGS
SITYRCEPGYTLHGASTLKCMTGERRAWDNPLPSCIAECGGRFKGESSGRILSPGYPFPY
DNNLRCTWTIEVDSGNIVSLQFLAFDTEASHDMLKVWDGPPENEMSLAELSGSLLPEGIH
STLNTVTVQFETDFYISKSGFAIQFSSSVATACRDPGVPMNGSRSGDGREPGDSVSFQCD
PGYELQGDDKITCIQVDNRYYWQPSPPVCIAPCGGNLTGSNGFILSPNYPHPYPHSKDCD
WLIAVNPDYVLSLAFISFNIEPNYDFLYIYDGPDSNSPLIGSFQDSKLPERIESSSNTML
LAFRSDGSVSYTGFHLEYKAKLRESCFDPGVVLNGTRLGSDYKLGSTVTFYCEAGYVLQG
YSTLTCSMGDDGRPGWNRALPSCQAPCGSRSTGSEGTVLSPNFPRNYTSGQTCVYSISVP
REFVLFGQFVLFQTSLNDVVEIYDGPTQQNTLLSSLSGSHSGESLPLSSGNQITIKFTTV
GPETAKGFHFVYQAVPRTSSTQCSSVPEPRFGKRLGNDFAVGALVQFECNPGYTLHGSTA
IRCESVPDNLAQWNDTLPTCIVPCGGVLTSRRGTILSPGYPEPYDNNQNCVWKVSVPEGA
GIQIQVVSFATEHNWDSLDFYDGADNHAPRLGSYSGTTIPPLLNSTSNNLYLSFSSDISV
SAAGFHLEYTAIGLESCPEPQTPNYGIRQGDRFMVGDVVQFSCEQGYSLQGNAHITCMPG
PVRRWNYPVPLCIAHCGGSMADVSGVILSPGYPGNYPSGLDCTWTVNLPVGFGIHLQFLN
FSTEAIHDYLEIRSGTLETGSVIDRFSGPVMPKPLFSTTHQTSFFFHSDYSQNKPGFHIT
YQAYQLQSCPDPRPFRNGIVIGTDFSVGMTVSFECLPGYSLIGEASLTCLHGISRNWNHP
LPRCEALCGGNITSLNGTIYSPGHPEEYPNFQDCVWSVRVPPGHGIYINFTVLSTEPIYD
YITVWDGPDQSSPQIGQFSGNTALESVYSTSNIILIKFHSDFSGAGFFVLSYHAYQLRVC
QPPPEVPNADMLMEDGELEIGDIIRYRCHPGFSLVGSEILTCRLGERLQMDSPPPTCQVQ
CPAHDVRYDSSGVILSPGWPESYPNLQMCSWSVTVEKGYNVTITFESFHTEREFDVLEIF
DGPTSNSPTLATLSGDLPTPFNLTTSGHQFLVRWSSDHGTNKKGFKIRYVALYCSTPDSP
LHGSISSQSGGHVNSVVRWACDRGYRLIGNATATCRRTSLGYHAWDSPVPACQAVSCGVP
KAPINGGVLTSDYSVGTRVSYFCNDGYRLSSKELTSAICQPDGTWSNHNKMPRCSVVVCP
SIGSFSLEHGRWRIVNGSHYEYKTRIVFTCDPGYYRLGPAHIECLSNGVWSWRNERPHCQ
VISCGELPSPANGKKIGTQTTFGATAIFTCDAGFMLVGSAVRECLSSGLWSGTETRCLAG
HCGIPEGIVNGQVIGENFGYRDTVVYQCLPGFRLIGSSVRICLQDNQWSGQLPICIPISC
GHPGSPIYGRTVGNGFNLNDVVSFVCNRGYEMEGPARAQCQANRQWSHPPPTCKVVNCSD
PGIPANSIRQSKIEHGNFTFGTVVFYDCNPGYYLFGSPVLTCQPTGQWDKPLPECIVVDC
GHPGSPPNGVLSGDKFTFGSTVRYSCLGGRQLKGESSRTCQLNGMWSAPMPFCSGDTTGS
CGDPGIPSHGSREQTDFRIRSKVYFSCSEGYELIGSSERMCFPNGTWSGTQPFCKPVQCG
NPGTPSNGKVFRLDGTTFSHSVIYSCMDGYLLTGPTTRQCQANGTWSGTQPNCTMINCGD
PGVPANGLRYGEDFTIGQNVSFQCQPGYRMEEDGSPVRMCTQNGTWNGNMPICTAVTCSA
PPAISNGVLQGNDFEWGSSVSYSCSPGYELSFPAVLTCVANGTWSGMLPQCLPKFCGDPG
TPVGGFREGRSFIYQSEVSFSCAPPLILVGTATRLCESDGTWSGTQPRCIEPTKTSCDNP
GTPRYGSLNRTYGFKVGSVVSFQCQPGHLIQGSSSRTCQPDLTWSGMQPECIPHACKQPE
SPLHVDVVGMDLPGFGYTLVYSCQHGYFLAGGSEHRVCKSDSTWTGKMPICRAGEKKKPV
KPVTGTPSPKLNVPDDVFAPNYIWKGSYNYRGRKQPITLSITSFNSTTGRVNVTLSNGNM
ELLLSGVYKASEARLLLLMYQVNYVNQGNQLKDSAISPAKIIDDSWTMDGFVSAEPDGSS
YVFQGSIQGKDYGQFGLQRLGLNMSESQNSPPPQLGTNSSSVAIAILVPFFALIFTGFGF
YLYKQRTTPKTQYTGCSVHENNNGQAAFENPMYNTNAKAVEGKAVRFDPNLNTVCTMV
Download sequence
Identical sequences I3J3P2
ENSONIP00000003482 ENSONIP00000003482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]