SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003485 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003485
Domain Number 1 Region: 577-838
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.48e-87
Family Eukaryotic proteases 0.00000496
Further Details:      
 
Domain Number 2 Region: 328-436
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-29
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 3 Region: 214-322
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-25
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 4 Region: 73-157
Classification Level Classification E-value
Superfamily SEA domain 0.000000000017
Family SEA domain 0.005
Further Details:      
 
Domain Number 5 Region: 512-547
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 476-513
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000111
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 441-477
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000101
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003485   Gene: ENSONIG00000002779   Transcript: ENSONIT00000003486
Sequence length 839
Comment pep:novel scaffold:Orenil1.0:GL831286.1:278239:299672:1 gene:ENSONIG00000002779 transcript:ENSONIT00000003486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSARYDKDDHSKHERIDFINQKEKAPPKSKTGIVIGVVVALLILSAIAAFLIWFFVFKD
ADSDAALSKQLRQSVPVFSGRMKLVNQPYDQNLEDTSSPEFQALAEKLETVLGNYLKKDP
ILEKYYTKSVVTAFSEGVRAYYWSQFNIPHSDLEMIPDVSEERILDALEHGIRQSRLATA
PDVKIREVTASLTDSRMARDPRANDCFYRLEADTNPQNFSSPGYPTSYPPKSRCQWQIRA
SEENVIIVNFLYFYIEDDCSDDFVYIYDSLSPDDSQAITKKCGQRPPSNPLEVVSSNNIM
LINFIAETDAEKPGFQASYRAIPKADVKCGGSLSQKEGNFTSPLYPSFYPPRKNCSWTIT
VAPGSKVRLRFTMFRMKEPGVDTRFCHKDYVEIMGNKYCGEVASLSLTSDTNVLVVNFHS
DQSHTDKGFSAVYSSYDPSNPCPDRFSCTNGLCIDRKLKCDGWNDCGDMSDERQCSCDTD
QFHCSNGMCKPKLWVCDRVNDCGDGSDEKMCGCAQNEFQCGNGVCLPQSVQCDDKQDCKD
GSDEVGCKTDRSICTDYSFKCKNGDCINKVNAECDRVQDCSDNSDEAICDCGTRPYKLNR
IVGGQNAELGEWPWQVSLHFLTNGPTCGASIISNTWLLSAAHCFVTSNPANKDPSSWQSY
SGMQNQYIHDNVQFRKLKRIIPHPLYNQMTSDYDIALLELSEPLQFANTIQPICLPDSSH
VFPAGMSCWVTGWGALREGAGQGAQILQKALVKIINDSVCDVVTEGQVTSRMLCSGYLSG
GVDACQGDSGGPLSCFEESGKWFQAGIVSWGEGCARRNKPGVYTRVTKLREWIKQETNI
Download sequence
Identical sequences I3J3P5
ENSONIP00000003485 XP_005472558.1.78416 ENSONIP00000003485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]