SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003601 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003601
Domain Number 1 Region: 365-514
Classification Level Classification E-value
Superfamily TRAF domain-like 4.58e-50
Family MATH domain 0.000000183
Further Details:      
 
Domain Number 2 Region: 326-364
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0000000000000497
Family Trimerization domain of TRAF 0.0018
Further Details:      
 
Domain Number 3 Region: 22-72
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000448
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 4 Region: 158-231
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000248
Family SIAH, seven in absentia homolog 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000003601
Domain Number - Region: 98-157
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000562
Family SIAH, seven in absentia homolog 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003601   Gene: ENSONIG00000002876   Transcript: ENSONIT00000003602
Sequence length 516
Comment pep:novel scaffold:Orenil1.0:GL831169.1:4644689:4651941:-1 gene:ENSONIG00000002876 transcript:ENSONIT00000003602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARISLDCPNSLPGIPLSVLSVPMENKYKCQQCLQVLRKPVQAQCGHRFCVHCFKQLTSS
GPKPCEACRQEEIYEEPISILNSSEAFPDNAAGREIASLPARCLNQGCNWTGSIKEYEAQ
HEGRCEFERILCEGCQTLILLTEKDRHDERECEARTLNCKYCKMTFNFKEIKAHDEICLK
FPMQCKDCGKKKIPREKFNDHVKSCAKSKSTCPFSEVGCKSMVENGKLCDHEVNYTMEHL
RLLLPLVLSATRAQSEGSGAGEWQEDSGVGLYRDPNEGAGPTTSVQSVDLEKKVNALENI
VCVLNREVERSSVTMEAFAHQHRLDQEKIENLSNKVRQLERTLTMRDLQLSETEQLVREL
QFCTYDGIFVWKISDFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGT
HLSLFFVVMRGRCDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDVSSSSFQRPISEMNI
ASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVDLTGL
Download sequence
Identical sequences I3J411
ENSONIP00000003601 ENSONIP00000003601 XP_003445283.1.78416 XP_013123763.1.78416 XP_019216609.1.78416 XP_019216610.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]