SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003671 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003671
Domain Number 1 Region: 667-877
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000307
Family Tropomyosin 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000003671
Domain Number - Region: 841-1104
Classification Level Classification E-value
Superfamily Tropomyosin 0.00654
Family Tropomyosin 0.00098
Further Details:      
 
Domain Number - Region: 209-327
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0628
Family Hemolysin E (HlyE, ClyA, SheA) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003671   Gene: ENSONIG00000002931   Transcript: ENSONIT00000003672
Sequence length 1163
Comment pep:novel scaffold:Orenil1.0:GL831140.1:7898749:7906880:-1 gene:ENSONIG00000002931 transcript:ENSONIT00000003672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTMTSNAERKFVNLRKRLDQLGYRQPLGIESLPLVEKLFSDLVHTTESLRNAKLSAGKSE
KENRNVDSLLEPYRTENARLVRENNELHLELLKLKEEKERVISELKTYIRKLDHETTDLK
FLNNQYVHKVRCLEKDSKAKSERIQQLQEKNLQAVVQTPGGKKRSIPFRRQRMQIDELVP
PSSTSAYPVQQPDDPYIADLLQLADGRIQELQEGVVKLKLDLENAQEVAKHLNTQVEERD
KEIDRLNGALHGGRPHDIISLEAQNISNEKLIAHLNLQIDYLQETNRTLEQKIDGLQQKK
KDASTEVASLSLKNLELCEELTHIDDLAKRMEMDKERVLETADMELQETKKEIQRQQKMI
EDLEGIITKTRREQSESDFEKDRLRDQLVELKEQNEKMEGLVNFLEDEKNRLQDKVEKMM
AADKELVLELEAMRTKYGVCGRERSPSRLDAFVKSLEEERDYYRKESERYKRARGAGGVD
ISPSRSPSRGRSPGSKVVRGGAAEAELLRVIQERDELKVALLDFEKHMEDIQNNMKALSN
ERDHFKTLFKQTQDELKLARRVDTSSNVVKLQEEIKRAEAKLEQMTTERDTLMERLKVAQ
TSALTDRQGEERRILNLENAVKSLERERLDLQSQVSLLKESKEAAEEELKVQSAAMVHNA
EEVAQQRAESNALRLLQEQMEKSLSDTQHRLSVKMNELHASHVQIEKLEERIGELSQQSS
KHKGELAVLHKSISALDKEKDALQDEVDQKTEKLVALQEELSNKEKTLEDVRLTVTNMDS
SLAQLQGALNSRERELNSLRRQLDASQEELAGLRREKEITIRENRRLQDDLATMTRENQA
VHAEMEESLHEKDELKLRLHSYISEVARVEKLIATKEQENRDLLERFRLAHVEMEERNQK
LQQAEGLSNSIRLELLSSDTERRHLRDAVGQQEKEIQQHMQAIQAYEAQVSSLVRGMSRL
EEELHKAQEEKAALLADLASVRELCVKLDSSKELTARQVTSRSMDLERVTGELEDVRSEA
EILKKQLASERLTVRNLETLLSTNRQKEFQTHLTASERESELKVLRDRLTLADSKTAEHA
REVSQLRGKVSQLQTEIDVLKRQLTTERFERERAVQEMRRQGLSFSTLQTSSSLSVSSSS
HHISPDRSILRSLDHSTDKSSDK
Download sequence
Identical sequences I3J481
ENSONIP00000003671 ENSONIP00000003671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]