SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003828 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003828
Domain Number 1 Region: 542-904
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.67e-118
Family Motor proteins 0.000000447
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000003828
Domain Number - Region: 180-323
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0418
Family Hemolysin E (HlyE, ClyA, SheA) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003828   Gene: ENSONIG00000003057   Transcript: ENSONIT00000003829
Sequence length 921
Comment pep:novel scaffold:Orenil1.0:GL831286.1:1548478:1555962:1 gene:ENSONIG00000003057 transcript:ENSONIT00000003829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYAFYSLLVYIFYTVFKKEEEEALEGACGDSPDEPGPVSMETGSRRRDGHTPKVGKKACA
RFSESSSSSDTDEMSNEDEEDAPDIPACTPLAAFLSFKQDAEKRRASQVQLETTEKLAES
PLVAVMSHLLSFLEQYSHFQQLQQQADQYRVQLKRHRVQHRRQMKALRASYRQRLRDKNS
IISSLEEAISQQQCPSPMSEAESSSDEGAQAGVHRLVQSLHGLQGERSKLRGELRLLHSQ
LEQKERDRHSRIQAFQQQIDELKSCIEEREEELSRLRTATGATDSEKRVLCLSAENESLK
QSLSVTQGLLQQLSTIPSQSSTMLIKENENLRGRVQQLELSLQQRAEQLSQMERRSEQSE
WRRGEELRKREDRVRELQLELDRERGKEPVIKYVTQTVEVESPATVKQLTKARQRNELLS
ERLSGQNERCKQLEEQIRKSDEYSCNLQHKIAAYEREISKLKEELLKEIGHLEERKEEAV
KAAANCSAEHFQNLQDQFFSLQKRLTSLPPTLRSMKTDYASLRSQVRNFSEFYGAAISEA
KKQISAAISEMSEANKDLLEKYRKEVALRRKYHEQLVELKGNIRVLCRVKPVLKEDQHEE
GHSVVVTTDPNNESSLTVLSKGKARIFEMDKVFHPQSTQEEVFQEIEPLVTSCIDGYHVC
IFAYGQTGSGKTYTMEGTVENPGINQRALKHLFSEIEERKDMWSYSVTVSSVEIYNEVLR
DLLSKDGEKLDIKINPDGTGQLHVPGLRVIEVKSFQHIKKILATARRNRITFGTQMNQHS
SRSHALLCITVQGTDLATGSKTTGKLNLVDLAGSERVWKSGAEGERLKEAQNINRSLLAL
GDVIQALRARQTHIPFRNSRLTYLLQDSLGKGSKTVMVVQVSALESNVGETLCSLKFAQR
VCKVELGPAARKIESGGGQCD
Download sequence
Identical sequences I3J4N8
ENSONIP00000003828 XP_019220596.1.78416 ENSONIP00000003828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]