SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003936 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003936
Domain Number 1 Region: 45-160
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-33
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 2 Region: 175-300
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-20
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 3 Region: 298-334
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000122
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003936   Gene: ENSONIG00000003140   Transcript: ENSONIT00000003937
Sequence length 540
Comment pep:novel scaffold:Orenil1.0:GL831133.1:7206147:7222595:-1 gene:ENSONIG00000003140 transcript:ENSONIT00000003937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNMEIICSVIRAWVLFFLIEEGFALAQRTKESPSDYGGQRPNQNDCGTWIRNINGGSFSS
PNYPNPYPPNKECVYILEALPRQRIQLSFDKNYYIEPSFECRFDHIEIRDGPFGFSPLID
RFCGGKNPEIVTSTGRFMWVKFTSDEELEGLGFRIEYTFIADPDFHLHVGGLLNPIPECQ
FNVGGWDGIIHSSQVEEEKRVKPGDALDCIWTIKAPSQSKIYLRFIDYQMEHSNECKKNF
VAVYDGSSAIENLKAKFCSTVANDVMLNNDMGVVRMWADEKSRLSRFRMLFTSFIDPPCN
DNTFFCHSNMCINNSLVCNGVQNCVYPWDENHCKEKRSKGLFHQITKTHGTVIGVSSGIV
LVLLIISILVQMKQPRKKVVARRPGVFNKAGFQEVFDPPHYELFSLRDKEMSSDLADLSE
ELDSFHKMRRSSTMSRCVHEHHCGSQGSVATGGGSMKHSRTTLSSMELSYHNDFSKPPPM
KTFNSTASYKKSCYGYKQHSQTHDCDQQVIEDRVTEETTCEIYGRGATVDPQQRSMSMDF
Download sequence
Identical sequences I3J4Z6
ENSONIP00000003936 ENSONIP00000003936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]