SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004004 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004004
Domain Number 1 Region: 5-47
Classification Level Classification E-value
Superfamily UBA-like 0.00000000151
Family TAP-C domain-like 0.024
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000004004
Domain Number - Region: 53-202
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 0.0101
Family Tex N-terminal region-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004004   Gene: ENSONIG00000003192   Transcript: ENSONIT00000004005
Sequence length 259
Comment pep:novel scaffold:Orenil1.0:GL831173.1:2126782:2128765:1 gene:ENSONIG00000003192 transcript:ENSONIT00000004005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHKLKSSQKDKVRQFMSFTQAGERTAVYCLAQNDWKLEVATDNYFQNPDLYYKESMKTSV
DRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLTLDPASMSILVVAWKFRAATQCEFSRK
EFLDGMAELGCDSPEKLKAILPRLEQELKDSGKFKDFYQFTFSFAKNPGQKGLDLEMAVA
YWNLVLTGRFKFLDLWNRFLLEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLI
DDFVEFARPIVMGTKRNVT
Download sequence
Identical sequences I3J564
ENSONIP00000004004 ENSONIP00000004004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]