SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004060 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004060
Domain Number 1 Region: 684-741
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000271
Family Tudor domain 0.00019
Further Details:      
 
Domain Number 2 Region: 268-329
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000397
Family UBA domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004060   Gene: ENSONIG00000003233   Transcript: ENSONIT00000004061
Sequence length 780
Comment pep:novel scaffold:Orenil1.0:GL831173.1:2939988:2956344:1 gene:ENSONIG00000003233 transcript:ENSONIT00000004061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDLTDSLTKEGWYLSDEGIAELKGSAEKITHSDIIRIALDTDLRTVGRKYLPSDINSGR
TEKLEGPCVLQVQKVRNISAPKDHEESQGAPRMLRLQMTDGHTTCVGLEFKHLSKISFNT
PPGTKVKLLGTVQVKNGLLLLDDSKISVLGGEVYHMVEKWELQRSLAKHSRSNIGAEGGP
PPFVPFGQKCARKDEVDSRELDQRKTLQTHSVVKSTDENDEFEKQRTAAIAEVAKTKEGP
RTFGGGGNAGGNLSNAASSSRSREPYQQRRREDRAERTESRQDGNYRELVDERALRHIME
MGFNREAARQALMDNNNNLEVALNSLLTGSSGSRPGPAAAESNKPQPRGRGKGRGRSRNE
DDQEGAGGRPSGPSTLFDFLESKMGVFSIDEPKSQAPQRHHENKGNFHNSDYHTKDAPQT
KFSSHNDHRQQRNDRPPRFHRDTDFPKPGQEPLSNCTTPQTSGQAQQWKGQERWSRGMSD
RSQSDKKEMRDEQIFPSSFVSVSTHSKDPQQQVEFSGSYNQRSRNGDGGGNMSAPSHRRG
APTSKLSNSAGSEANGKGNKRVDRNEDFNNSRRKGKMERANSDHPERQRDSGPANFNSKG
GGSEVGSSQSSYIPTGDPSHFQNGVIEHKRTGPIKPQTSSFPPNREPPPPKKNTANNPGS
KRRGGQGKGQGPRGSERGHISEQMWKPGDECLALYWEDSKFYHARIDAVHPSGSTAVVVF
SDYGNCEEVLLNNIKPLDADVMEEDDGYYDSSLEFRRGGDGQPRRTRPTQQYYQPPRARD
Download sequence
Identical sequences I3J5C0
ENSONIP00000004060 XP_005466916.1.78416 ENSONIP00000004060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]