SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004239 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000004239
Domain Number - Region: 150-328
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000837
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.017
Further Details:      
 
Domain Number - Region: 385-441
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.018
Family HBL-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004239   Gene: ENSONIG00000003366   Transcript: ENSONIT00000004240
Sequence length 454
Comment pep:novel scaffold:Orenil1.0:GL831180.1:4347400:4356556:1 gene:ENSONIG00000003366 transcript:ENSONIT00000004240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTENTFPVYTADAIVNFYRTEVLTGQEAKHFTKSDLTPHPKPEAVQTLYMRVLHLLYRFR
PECHSMVPLLENIQYPAYHEGATAIMSVYTRMQQFLPMCLVLDFSLNDLLAPKKQRTLTI
LSAIMNFLHFRKQRMEVVLEKQTKFRADMDRLQAYTKGIREAEKKIEMLTTIPPEQQAEA
DELAATLSELQATTMHEYQEVNAKNESITEWKATIAEKTQKLAQVKLDVSNLKEDISKLK
SQIVESPEELKSQMEKMRENVKNIKNSIEETDERVVELQNMVQGVTHTEAEIQQMYSLLQ
DLESSMNNTKQRLEEHQELMAQYEKKQKELKNLCMEEGQLKRALGMKQDKECKQNIRRQK
KREMKEQHVQEVLGQCDQIHQKREEMADKIQEISAETQKLKTSIKSLRDVCNKETEKAQA
LYDTLSTSMDELHKRIEMHTMDLKLNLTKMSANF
Download sequence
Identical sequences I3J5U9
ENSONIP00000004239 ENSONIP00000004239 XP_003446547.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]