SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004411 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004411
Domain Number 1 Region: 110-306
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.4e-59
Family Astacin 0.0000939
Further Details:      
 
Domain Number 2 Region: 734-846
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-37
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 3 Region: 429-531
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-36
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 4 Region: 313-422
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-35
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 5 Region: 579-689
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-35
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 6 Region: 870-963
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-29
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 7 Region: 687-731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000352
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 8 Region: 533-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000137
Family EGF-type module 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004411   Gene: ENSONIG00000003503   Transcript: ENSONIT00000004413
Sequence length 974
Comment pep:novel scaffold:Orenil1.0:GL831163.1:55232:74824:1 gene:ENSONIG00000003503 transcript:ENSONIT00000004413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAPRFLFLLCGLCVSLAADWETVETTFTDLGDEIDYKDPCKAAAFLGDIALDEDDLRL
FKGARGGDDAQHAVQSNHTNSANSSTSSENRRSERAADRQSLRRQRRAATARPERVWPDG
IIPYVISGNFSGSQRAIFRQAMRHWEKHTCVTFTERTTEESYIVFTYRPCGCCSYVGRRG
GGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVSIIRDNIQQGQEYNFLKME
PGEVDSLGEVYDFGSIMHYARNTFSRGIFLDTILPRYDVNGVRPSIGQRTKLSKGDIAQA
CKLYKCAKCGESLQDSSGNFSSPGFPNGYSAYTHCVWRISVTPGEKIVLNFTSMDLFRSH
LCWYDHVEVRDGFWRKAPLKGRFCGDTLPAQIISTDSRLWIEFRSSSSWVGKGFSAIYEA
ICGGEVKRESGQIQSPNYPDEYQSNKECVWKITVAEGFDVGLSFQSFEIEKHDSCAYDYV
EVRDGASESSPLLGRFCGYDKPDDIKSTSNQLWLKFASDGSVNKAGFAANFFKEMDECSR
PDNGNCEQRCLNTLGSYRCACDPGYELAADKHTCETAACGGFITKLNGSITTPGWPKEYP
PNKNCVWQLVAPIQYRITLVFDVFETEGNDVCKYDFVEVRSGLSSDSKLHGKFCGAEKPE
VITSQQNNMRIEFKSDNTVSKRGFKAHFFSDIDECSKGNGGCQHECVNTFGSYSCQCRRG
FMLHDNRHDCKEAGCDHVINSVSGTIASPNWPDKYPSKKACTWSLSTTPGHRIKLIFNEV
DMEAHLECAYDHLEIYDGRDNRAASLGRFCGTKKPSPVISSANKMFLRFFSDNSVQKRGF
EASYRAECGGSFKAEVKTKDLYSHAQFGDNNYPGGSDCLWVVTAEKGYGVEIIFQVFEIE
EEADCGYDYVELYDGADTKSPRLGRYCGSGAPEDVYSAGDSIVLKFHSDDSINKKGFHVR
YTSTKFQDTLHASK
Download sequence
Identical sequences I3J6C1
ENSONIP00000004411 XP_005451331.1.78416 ENSONIP00000004411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]