SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004493 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004493
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000841
Further Details:      
 
Domain Number 2 Region: 143-254
Classification Level Classification E-value
Superfamily SRCR-like 6.28e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00023
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000004493
Domain Number - Region: 240-287
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0066
Family C1 set domains (antibody constant domain-like) 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004493   Gene: ENSONIG00000003570   Transcript: ENSONIT00000004495
Sequence length 306
Comment pep:novel scaffold:Orenil1.0:GL831219.1:22892:39944:-1 gene:ENSONIG00000003570 transcript:ENSONIT00000004495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLAGNGSTRCSGRVEIYKSYYNYNSYRYGSWGTVCDDDWDVKDAEVVCRELNCGIALEA
LGSAYFGQGTGTIMLDDVDCSGSETSLNDCRHRGLRTHNCGHSEDAGVVCSETPPEPTLS
LYSNEVTWAMSVPSVTTENRSLIRLAGYGATRCSGRVEIYKSYYDYNSYHYRSSWGTVCD
DGWDLKDAEVVCRELSCGIALEARWSPYFGQGTGTILRSNVDCSGSEISIDNCRYSSPVR
YYCHHGRDAGVVCSVSNPEPTIFLYSNEVTWGQDISITCSVSDKFSGGTFILHKTSSSFS
HTQPSS
Download sequence
Identical sequences I3J6K3
ENSONIP00000004493 ENSONIP00000004493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]