SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004622 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004622
Domain Number 1 Region: 11-368
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.44e-94
Family Regulator of chromosome condensation RCC1 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004622   Gene: ENSONIG00000003674   Transcript: ENSONIT00000004625
Sequence length 1206
Comment pep:novel scaffold:Orenil1.0:GL831292.1:1811833:1821737:-1 gene:ENSONIG00000003674 transcript:ENSONIT00000004625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGEAEDDIPESGAVFTFGKSKFADNIPSKFWLKNDIPLRIACGDEHTALITENGKLFMF
GSNNWGQLGLGSKVTVNKPTCVKALKSEKVQLVACGRNHTLICTAKGKVYASGGNSEGQL
GLGDCEERTSFKRLDFFDSQGPIKMLAAGSNTSAALTVSGKLFMWGDNTEGQIGLGKESQ
VSSPQEVSVGQPISWVSCGYYHSALVTVDGALYTFGERDSGKLGLGTHQLPGHRVPQLVK
SIKEPVRQVACGGGHTVALAEGNVYTFGLGQFGQLGHGTFIFESRVPRLVEHFKKGRACQ
VVCGENHTAVITEDGLLYTFGDGRHGKLGLGEENFTNQFKPTLCLRFLKYNVQGAMCGGC
HMVVLARPRARGAGEITLEDNDVTEDFLEKPYVELQGNTVDSSTLQRSLSARVRRRERER
SPDQFGTMFRTLPAMTPGNLLPPLTVSSQTIPPRLAPPEVIHGKVLNGTYQHRNEGSIHQ
ESLTDTDSVRGLGETRDFLNMTHVMKIDPSDKTLTLSPVQKKNGKAIKEQGQRKQRKLSE
QSSFSSTSLSCKSEAASSLRALPTELLRSRSTRTQGPQRPQRHQKSNQNKANLILAVEEL
QEKPSTNKPTSIRDINKAASKEQQMQVHSKSQVIGVRRKLAADSKQSPEIMKKRLDFNSK
SAKVEKVESKPVRVKGTPTGISSPGKLSHTDSASFHLSDTLDEESIVGSQQVSEVKKTPK
SKEKKTDLSKKNKNEKNMKDAQIKRGSEVQKKSTDLSLVVGAASLAAGAALIQAGRRLSS
TSLSENSCAVLKESVTKSLSEESESYAANFSHKSAVSINIIPAPESPEMRTISDQSEQMD
SAAIKEEEEDNEEAVEEEEGQTDAEVSEEEEDVSHIIKKVAENAEDEKESDTLQSGEKSD
SDVDEEEDESNVVVEDEEEEEEKSGVTESESKAETEEKDRNGGVVEEEEAEEEESEEGSS
HETESKRGDTESDLEEGDEEEEGSLESEGEEEEVESESVRSSEREESEEERETEEGEDEK
EEEEKGSAEEVEESSEEENSEIEEEEEEEQSGEKEEETEDEEEEEEKEEDEQSEEKEEET
EDEEEAEEKEEEESEEKEEETEDEEEEEEEGEEEEESEEKEAEAEDEEDQSEEEEEQEEE
EEEEKEDEEEEEEEEKAVKKKRSAEVKRISAKSATRSKLRLGVKGQAAGESEEFWDDVLP
QYLNLK
Download sequence
Identical sequences I3J6Y2
ENSONIP00000004622 ENSONIP00000004622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]