SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004631 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004631
Domain Number 1 Region: 271-423
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.34e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000062
Further Details:      
 
Domain Number 2 Region: 426-583
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000000547
Further Details:      
 
Domain Number 3 Region: 642-804
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-35
Family MAM domain 0.0021
Further Details:      
 
Domain Number 4 Region: 33-139
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-34
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 5 Region: 144-262
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-30
Family Spermadhesin, CUB domain 0.0000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004631   Gene: ENSONIG00000003681   Transcript: ENSONIT00000004634
Sequence length 922
Comment pep:novel scaffold:Orenil1.0:GL831219.1:1549362:1606259:1 gene:ENSONIG00000003681 transcript:ENSONIT00000004634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHCGLVFILFMGILSVAKAFKNDKCGGNIRISTANYLTSPGYPASYPPSQRCVWVISAPG
PHQRILINFNPHFDLEDRECKYDYVEVRDGTDESGQLVGKYCGKIAPSPVVSSGNQLFIK
FVSDYETHGAGFSIRYEIFKTGPECSRNFTSNSGIIKSPGFPEKYPNNLDCTFMIFAPKM
SEIILEFESFELEPDPTPPTGVFCRYDRLEIWDGFPGVGPHVGRYCGQNTPGRIISYTGI
LALTINTDSAIAKEGFSANFTVIERTVPEDFDCSDPLGMESGEITSDQIMVSSQYNPSWS
PERSRLNYYENAWTPAEDSNKEWIQVDLGFLRFVSAIGTQGAISQETQRVYFVKSYKVDV
SSNGEDWITLKEGSKQKVFQGNTNPTDVAKTKLPKPTLTRFVRIRPVTWETGIALRFEVY
GCKISEYPCSGMLGMVSGLINDNQITASSHTDRSWVPENARLLTSRTGWTLLPQPQPFTN
EWLQVDLGEEKLVRGLIIQGGKHRENKVFMKKFRLGYSNNGSDWRMVLDTSGNRPKIFEG
NSNYDTPELRTVEPLLTRFVRIYPERATPAGMGLRLELLGCEIEAPTLPPTTAIPSTTPS
DECDDDQASCHSGTGDDYDVTGGNMMPESTTAEMDTIPAFLWFACDFGRANDPSFCSWTS
EDTGSRWQIQSSGTPTLNIGPNMDHTGEPGNFIYTLATSPQETEVARLVSPVVSSPDSDL
CVSFWYHMFGPHIGTLHIKQRKQTEKGPADVLLWTVSGHQGNRWREGRVLVPRTNKPYQV
VIESLVERKSWGDIAVDDIKVLDGITLPDCKDPDVPTEPILPEDINEIIPENTDYPDSVE
TNQIPEGSMLKTLDPILITIIAMSALGVFLGAICGVVLYCACSHGGMSDRNLSALENYNF
ELVDGVKLKKDKLNVQSSYSEA
Download sequence
Identical sequences I3J6Z1
ENSONIP00000004631 ENSONIP00000004631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]