SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004774 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004774
Domain Number 1 Region: 1044-1140
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 7.5e-34
Family CUT domain 0.0000134
Further Details:      
 
Domain Number 2 Region: 584-675
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.5e-28
Family CUT domain 0.000067
Further Details:      
 
Domain Number 3 Region: 1172-1234
Classification Level Classification E-value
Superfamily Homeodomain-like 8.77e-16
Family Homeodomain 0.0075
Further Details:      
 
Domain Number 4 Region: 897-980
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000161
Family CUT domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000004774
Domain Number - Region: 300-359
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0288
Family HBL-like 0.026
Further Details:      
 
Domain Number - Region: 17-231
Classification Level Classification E-value
Superfamily Tropomyosin 0.0719
Family Tropomyosin 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004774   Gene: ENSONIG00000003797   Transcript: ENSONIT00000004777
Sequence length 1396
Comment pep:known scaffold:Orenil1.0:GL831295.1:1436259:1489034:1 gene:ENSONIG00000003797 transcript:ENSONIT00000004777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAANAGSMFQYWKRFDLQQLQKELDVTATQLANRQDESEQSRKKLIDLSREFKKNTPEDL
RKQVAPLLKSFQGEIDALSKRSKEAEAAFLNVYKKIIDVPDPVPVLELAQQLQLKLQRMH
DIETENTKLRETLEDYNKEFAEVKNQEVTIKALKEKIREYEQSLKNQAENLAQEKQLQLH
NDYAEKERKLQESQDSMSSRLEEAEQKARSLQTALETTQAELFDLKTKYDEESTAKADEI
EILMTDLERANQRAEAAQREAESLREQLSLSSQSQQLSSPAKADPNTEQSEEVASHSNLE
AELRAKERETAQLVEDVQRLQASLTKLRETTSSQISQLEQQLNSKSEVLKELEEKLQKQA
DYEEVKKELSILKAMEFGASDSVQDSSKPLEVLLLERNRSLQSESAALRIANTELSGSAG
RKGTEESTTKEETAPSDPSSSPPPPPPSLPSSSQLPLSRTHTDPLNTATTTSSSSSSETL
PFAPTGIGQDFYSPVFPLVGGKMALNSLIQRQLLQTFYSKALQESSGIPSGALLFTPFTP
TLSSIPTSTPGSGSAAIPLAASSPQPPPASPDMAPVNGSSTAGSAPSPSPSHSDANTGSV
LDGEDMDTAEIARQVKEQLIKHNIGQRVFGHYVLGLSQGSVSEILARPKPWNKLTIRGKE
PFHKMRQFLADEQNILALRSIQGRQREGSGQPQLSRVFQDAPKRRTLSDTASHTGNITAR
VRTPEAGSDEAIKSILEQAKRELQVQKADLSHAQPSYAGLKGGGGGGIGSGGGSGSDEAI
RSILEQARREMEAQQAALEPILKASSSSSSSASLSQRDILSSSLTAPLPPYNPLALSLKK
PPSSLLSSPSSPSPILDFSSSVKREGRGSSGVDMSADGALRMGRSSEGLSRSGSAGGAGY
WREQWWSNMQTDPRRTMSSQTVEENHNQEDSKEGILTDSLSRHKPWNKLNQRSREAYLRM
QPWLNGDQGQNAHIQQTQNQEGTPKTSASCSPAPESPLSSAEESVNGLAGDPLASQSSSL
KPPSEDPSGGESQPGTPLPLPGHSGLSIQEMVAMSPELDTYAITKKVKEVLTDNNLGQRL
FGETILGLTQGSVSDLLARPKPWHKLSLKGREPFVRMQLWLQDPHSVEKLMDMKRLEKKA
YMKRRLSSLSDGHSVDGGLVGSEYMQGSQSPGQQQLKKPRVVLGPEEKEALKKAYQQKPY
PSPKTIEELASQLNLKTSTVINWFHNYRSRIRRELFIEEIQAAGGVGPGSEAGSPSLRGS
KSGEGDSCDGTESEGTVETRQSLGIGLEDHRGACKDHDMEAESEAGGSNNSPAQLDCTAT
GLAGPGSSGGQGGLGLFSLTEASSSSSASSTNIPASGPARNPRDNNLRKKKAANLNNIIH
RLEKAASKEDPSEWEF
Download sequence
Identical sequences I3J7D4
ENSONIP00000004774 ENSONIP00000004774 XP_005459425.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]