SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005053 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000005053
Domain Number - Region: 85-146
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0314
Family HBL-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005053   Gene: ENSONIG00000004009   Transcript: ENSONIT00000005057
Sequence length 156
Comment pep:novel scaffold:Orenil1.0:GL831494.1:202031:204908:-1 gene:ENSONIG00000004009 transcript:ENSONIT00000005057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVGAFPIAKLLYLGVRQMSKPVANRIKAGARRSEFFKTYICLPPAQLYHWIEMRTKMRI
MGFRGATIKPLNEESAAELGAELLGEAIIFLIGGGCMVLEYSRQAANSRRKEEELNETLI
SLQTQLAELSLTTETLSAQLREVNRQLLSFPVPTKK
Download sequence
Identical sequences I3J863
ENSONIP00000005053 XP_003459159.1.78416 ENSONIP00000005053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]