SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005062 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005062
Domain Number 1 Region: 18-99
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.49e-35
Family PB1 domain 0.0000463
Further Details:      
 
Domain Number 2 Region: 138-258
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-22
Family PDZ domain 0.00000513
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005062   Gene: ENSONIG00000004016   Transcript: ENSONIT00000005066
Sequence length 413
Comment pep:novel scaffold:Orenil1.0:GL831206.1:2090076:2109686:-1 gene:ENSONIG00000004016 transcript:ENSONIT00000005066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQQQQQQRTSFRLSDNLVEVKSKFDAEYRRFALKRNGPGGFKEFYRLLQTIHHIPGVD
VLLGYADVHGDLLPINNDENYHKAIASANPLLRIIITKREDEPIIFGTNSLQRRRKGLGL
TSLRTTGSGSTHSKNRSGLMIGPPKNFRQISSIIDVDILPETHRRVRLHKHGTQKPLGFY
IRDGVSVRVTPQGVEKVPGVFISRLVRGGLAESTGLLGVNDEILEVNGIDVAGKSLDQVT
DMMVANSHNLIVTVKPANQRNNVTHRSSKTSVGNSGSLGSVGSTGSAVSHDSQSPASLSN
PITASNSIAEGDSDDGGDDEDEGDLILENDCLTPYDSHRVTNSTTMPDRDSLSNGPHSYT
VGRPLPQSVSLPSNVGASLRDSAMMISSHNGNSTHTTSSSEESMREDGNITAL
Download sequence
Identical sequences I3J872
XP_005454276.1.78416 ENSONIP00000005062 ENSONIP00000005062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]