SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005130 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005130
Domain Number 1 Region: 586-842
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.03e-93
Family Eukaryotic proteases 0.00000309
Further Details:      
 
Domain Number 2 Region: 328-437
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-25
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 
Domain Number 3 Region: 210-315
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.15e-21
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 4 Region: 64-163
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000000497
Family SEA domain 0.0099
Further Details:      
 
Domain Number 5 Region: 442-478
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 514-549
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 7 Region: 477-514
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 8 Region: 558-598
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000367
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005130   Gene: ENSONIG00000004071   Transcript: ENSONIT00000005134
Sequence length 843
Comment pep:novel scaffold:Orenil1.0:GL831494.1:354130:366616:-1 gene:ENSONIG00000004071 transcript:ENSONIT00000005134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLSGTRYTPAPDKDWDINVHLPASNTKRLEKKKHPGKTGAVIGVVIFAAVVALMVGIL
VWHFHFRKHQRVKRMYSGSMRITNQAFINAYENSSTPEFKALAKQVISQLKVVYSKSPQL
SKYYRESTVQAFSEGSVIAYYLSEFNVPVGQERAVDNEMTSVETLVKKMRNSMRTSNELT
FENVVTSAMDDRMFSRSFLGNLQFEEHTKVDYIGRIQSPGFPDSPYPPNTFIQWQLRADP
GYVVKLEFGTFELEESCENDFIKIYDSLVPIESLLMEELCGKYLPNKRLSFLSSGNVMLV
TMATHDQSFPGFIAEVSQVQKGNKAIACGEKLIGSKGNFSSPNHPNYYPPKITCEWLIEV
PAGKVVKLVFKKLLLSQLGKKNTNCDKDYVEVNGKKWCGEKPDGSVTETSSTNNMTVVFY
SDESRVDHGFSAQYEAIDVQNPCPDKFRCRNNNCIKLALKCDGWNDCGDMSDELECSCSS
ADIRCRNGFCKPMFWKCDGVNDCGDNTDEMDCGCASGQITCKNGNCVSEKLKCDGKDDCG
DGTDEQDCTKATGGLTVSCTDFTYKCKDNKCISKVNPECDGMTDCGDGSDEENCDCGTRG
KSQRIVGGQNAELGEFPWQISLHVKSHGHVCGASLISPKWLVTAAHCVQDEGSLKLSQPG
SWEVYLGLHEQRKTQDPVQKRNLKQVIPHPNYNKFTFDNDIALMELDSPVTYSDFIKPIC
LPAPQHEFPPGQSVWITGWGATREGGSAAVVLQKASVRIINQAVCNELMGGQITSRMFCA
GVLTGGVDACQGDSGGPLSSLSGSRMFLAGVVSWGDGCARRNKPGIYTTVTKYRGWIKEK
TGV
Download sequence
Identical sequences I3J8E0
ENSONIP00000005130 ENSONIP00000005130 XP_005474858.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]