SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005490 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005490
Domain Number 1 Region: 1364-1419,1451-1641
Classification Level Classification E-value
Superfamily VPS9 domain 1.44e-37
Family VPS9 domain 0.0027
Further Details:      
 
Domain Number 2 Region: 24-216
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.23e-36
Family Regulator of chromosome condensation RCC1 0.0025
Further Details:      
 
Domain Number 3 Region: 525-687
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.71e-27
Family Regulator of chromosome condensation RCC1 0.027
Further Details:      
 
Domain Number 4 Region: 1034-1123
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 3.27e-23
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0069
Further Details:      
 
Domain Number 5 Region: 1129-1236
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 3.4e-19
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0094
Further Details:      
 
Domain Number 6 Region: 921-1008
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000155
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Domain Number 7 Region: 693-892
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000929
Family DBL homology domain (DH-domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005490   Gene: ENSONIG00000004358   Transcript: ENSONIT00000005494
Sequence length 1645
Comment pep:novel scaffold:Orenil1.0:GL831170.1:2712050:2739793:-1 gene:ENSONIG00000004358 transcript:ENSONIT00000005494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLADEQAHTSPDRGLLHVWHSAGHSRQLCPDRVLLSRPVLQVSLGEHHGLLLAQGGQVYS
FGELLWRDLSVPVSAPVPEVSLLGKTMVHVAAGGFHCGALSEQGSVYMWGENTAGQCGQT
EKGTVTNITVPEPCPVSVVDGEVVPPVVVRVVDLACGREHSLALSAQNELWAWGSGCQLG
LVTSTFPVGKPQKVEHLAGRHVIQVACGAYHSLALVRRLPPQDYNTQHAPKKKERGQSPH
YSVTEREELSAVEDSHYCPLGVELTEVMKANFDRVKWEAWNKTLNSESFILEYITQASSQ
VRGPRRRLRAGATSASSSPGSDDSKSNTKQNFSPNLESQGQTDSVTETDGSPKVHLLSAD
ELELQNLLEKLSDQSLDKQDTDSLSSHTSDDSCISSTPSSDLLTSSYKDDLNTKRQMHNL
TFDLLFHSNSGLSGSHSSSPVCLNEVRLCLEKEKRSLQGLKSSSLTNIYQKGKTATSRRS
SLPGTPTHGSPRRRHPCACRPSSAGGASAGAPEEAEDGLPFLETEIWSWGRGSEGQLGHG
DQLARLQPLCVKSLTGEEVIKVAAGSHHSLALTAQCQVYSWGSNMCGQLGHVNIPVTVPQ
QAKLSDGLRVWDLSAGQSHSLLLADGDCVQPVLLYCGQQKEPVQTERLNQSESSIMPTLL
PFCIEMGYVSSVCSGGQSCAVLADHNVMGFISAIHELASRERHLYCWCSSVRKILLTPLR
KRVLGEQCTHLFFSLCESFVQLSTLIGRHATALTYFLHNVQGCDVTTLPLLTHTEYFIDA
YKRYFSSLGDFQVMGGFQPLHKLSLESLGFRQTLLTQLSVSDQSASGDVDLVSMLYWPLQ
QLHQYSRALLKLAACYDVLTVEYKSLDQGHKDCESLSSSLLRRKKEAETTFLFWKTHSGK
TTECLRLPRRRVVCESSNRSLTLQNAGRFSNHWFILFNDALVHTQFSTHHVYPLTCLWVK
PVTENGSGLHALKITCPEESFTLVASTPQEKNKWLRSLNQTVDQILGGGGQGSSPAMTRT
ASYTFTADERFKDAQYTGSWLAGRVHGRGTMKWPDGRLYKGNFKNGLEDGYGECVIPNKL
LNKTDTYQGQWREGKIHGFGKYKYASGEVYEGCFCDGQRHGYGMLSSGKLARNSSSVFIG
QWVHDKRTGYGVYDDITRGEKYMGMWLDDQRHGSAVIITQHGVYFEGAFRENKMSGLGLL
MSDDDTVFHGEFTDDWTISGKGILTMPNGDSLDGQFSGEWSSGLKVVGTYTKPGIDEPPN
KEKNGLNRLGQYAVPADQRWICVFDECWSRLGCEAAGKGERTTAWENIAVTITTARRQRR
NIPDLSRSQTKVLECLEFIPQYEDPVTAANYDNIRRYLTKACETPHHPLGWLVETLVTAY
RMTYVGVGSNRRLLRQAVQEVLAYLTHFYSVIRFLFPGLPDDGSVLPDAPTSPSKSRRNS
YTTGQSSSTTLSSSCVMVVSSSSLLLPLLLPRLYPPLFTLYSLQEEQEETEYWERILRLN
KQPDQSLLSFLEVQEKFWPLWMSILGEKKQIVSSSKDACFVSAVETLQQISTRFTPSDKL
MVIQKSFEELTLEVKPLLDGDFLWCMDDLFPLFLYVVLRARIRNLGAEISLIEDLMDPNI
QHGELGLMFTTLKACYIQIQQETNA
Download sequence
Identical sequences I3J9F0
ENSONIP00000005490 ENSONIP00000005490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]