SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005840 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005840
Domain Number 1 Region: 312-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000014
Family Laminin-type module 0.057
Further Details:      
 
Domain Number 2 Region: 249-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000019
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 3 Region: 427-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Laminin-type module 0.0044
Further Details:      
 
Domain Number 4 Region: 375-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000173
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 5 Region: 476-526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000184
Family Laminin-type module 0.036
Further Details:      
 
Domain Number 6 Region: 524-563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000005840
Domain Number - Region: 918-1022
Classification Level Classification E-value
Superfamily Prefoldin 0.000837
Family Prefoldin 0.021
Further Details:      
 
Domain Number - Region: 824-960,989-1051
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00706
Family Hemolysin E (HlyE, ClyA, SheA) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005840   Gene: ENSONIG00000004636   Transcript: ENSONIT00000005844
Sequence length 1062
Comment pep:novel scaffold:Orenil1.0:GL831525.1:32403:49989:-1 gene:ENSONIG00000004636 transcript:ENSONIT00000005844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRILLLLAASAILSHAQNDCSWGACYPPTDDLLLGRAHQLQASSTCGLTGSEIFCTPYQQ
RKMKCCPCDSRNPNSQLAHTVQDVVSTSGPDRWWQSQKETSPVTLQLNLNNLFQLDNLVL
NFKGPRPSALVIERTLDNGKTWQPTLYMATNCQKAFPSVPTRVPLAMEQTYCYTLPPTDT
NPYKDHTIEYSPLHQYAYVAAPKSQKIEDVSGLTGLRVRFTELGDVPHLPGRSLSRFYAL
KEMKVMGSCMCHGHANRCLPQGYSSSLLPSTIQVNAQCDCQHNTAGVNCERCADLYNDLP
WRPAEEGNTHGCECNNHAQRCRFDWAVYEASGQRSGGVCENCMHHTTGPKCDQCAPGYQP
NPRSRMDRPDACIRCICSAEGTVNSGRCDDSTGSCQCKANVEGPRCDRCKMGYHGLSSSN
PLGCTKCSCSPHGSLSDVCDPSTGQCLCLPHFHGITCNVCVKGYWKPNMSETCKPCGCDA
TKSTTDSCDQLTGQCQCRSGFGGRTCTECPDNTYGDPLKGCQPCDCDASGTLPGVCDKQS
GVCLCRPGVSGARCDSCSPDRCDSFPDCEMCPSCFFNLNTQQKNLRSVLLRLASRLSSQS
GGAADFGPRISDLEASLKIIQNSMSLSPITDTRDALSKLKKLRWETAEELNSRYQVDNDL
SPLTKTPGLDSELDKLQDLLESFTLVYNAKKAVTENSISPNNIGAFTAISNAYDNSTDAT
KKVEAGKNTIKESTDVREKTEDIQSKVQPANTRDLDKLNNSMASQPNLTPVARQVCGSVH
SEPCTPLQCEIGDLCTPVGDAPCEKGGKCVGALPLSKRADADAKDVKEGLDKLSGRITDA
AEKLQKTQEMTNQVRQSTEKLSSKLQQARDELEDDLNETRSVVKELKDFLSDPSANLTHV
QKVSDWILNAKLPPRLAGLKGKLQELKDLTANLPDSTAVLREAEPQLDAAKKLLQDAQDA
RDTALGVKADVDGLLAGFSSVSPSLAELEDKLQDKMDVIETLNNNLTKAKDQLVPAEKAL
DDVSTLIKPMKPQLDKLKDLLQDGGQLAEDARENAEKADKEA
Download sequence
Identical sequences I3JAF0
ENSONIP00000005840 ENSONIP00000005840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]