SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005842 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005842
Domain Number 1 Region: 33-93,132-190
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000445
Family Spermadhesin, CUB domain 0.0094
Further Details:      
 
Domain Number 2 Region: 199-232
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005842   Gene: ENSONIG00000004638   Transcript: ENSONIT00000005846
Sequence length 291
Comment pep:novel scaffold:Orenil1.0:GL831525.1:96493:133017:-1 gene:ENSONIG00000004638 transcript:ENSONIT00000005846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESCNQRVFTLLLLLRCFMSLSTSAIDTVNVVDFCGQTIQGDGMIINSHQESKKYYFVIM
GTDCHLTMQASSPKDKVQFYFRFFLVYSLLRVAPLSPAPVLPESPSPHGSAPLSPRLQST
SGENSEDPCHAGSYVQFYDGRDRSSPPLGPPLCGKSPPRPVLSTGNYLTLRLVTRGTQPR
VDFVGDFTSFRLGFNQSDCSNEPYFTCRNGKCIPLSLVCDEKGIDNCGDGSDLEENLTTG
CKGGQLLPPEPSPAIATSPHPFLSPPTVPFLTRTNCGAPIGPPSPESVAGT
Download sequence
Identical sequences I3JAF2
ENSONIP00000005842 ENSONIP00000005842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]