SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005907 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005907
Domain Number 1 Region: 1456-1564
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-34
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 2 Region: 755-869
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-33
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 3 Region: 1802-1921
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-32
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 4 Region: 1979-2088
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-31
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 5 Region: 35-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-31
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 6 Region: 211-314
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-31
Family Spermadhesin, CUB domain 0.00087
Further Details:      
 
Domain Number 7 Region: 587-696
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-30
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 8 Region: 415-525
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-30
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 9 Region: 1280-1388
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-28
Family Spermadhesin, CUB domain 0.00072
Further Details:      
 
Domain Number 10 Region: 1107-1216
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-28
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 11 Region: 2151-2258
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-26
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 12 Region: 934-1043
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.15e-25
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 13 Region: 1624-1739
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.1e-23
Family Spermadhesin, CUB domain 0.004
Further Details:      
 
Domain Number 14 Region: 2320-2438
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-23
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 15 Region: 3101-3170
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.35e-18
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 16 Region: 2925-2992
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-18
Family Complement control module/SCR domain 0.00079
Further Details:      
 
Domain Number 17 Region: 3041-3112
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-18
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 18 Region: 2685-2752
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.23e-17
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 19 Region: 2742-2810
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 20 Region: 2437-2510
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-16
Family Complement control module/SCR domain 0.00065
Further Details:      
 
Domain Number 21 Region: 2982-3052
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.98e-16
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 22 Region: 2627-2689
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000667
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 23 Region: 352-424
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000792
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 24 Region: 1569-1634
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 25 Region: 2802-2870
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 26 Region: 2500-2566
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000283
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 27 Region: 3221-3287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000292
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 28 Region: 1920-1982
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000542
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 29 Region: 1219-1284
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000661
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 30 Region: 1394-1462
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000809
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 31 Region: 876-936
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000931
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 32 Region: 1746-1811
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000243
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 33 Region: 3159-3216
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000032
Family Complement control module/SCR domain 0.00074
Further Details:      
 
Domain Number 34 Region: 530-595
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000486
Family Complement control module/SCR domain 0.00088
Further Details:      
 
Domain Number 35 Region: 2093-2161
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000513
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 36 Region: 148-208
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000283
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 37 Region: 701-764
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000417
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 38 Region: 2857-2918
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000806
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 39 Region: 3276-3337
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000181
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 40 Region: 2263-2327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000378
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 41 Region: 1049-1112
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000432
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 42 Region: 2572-2637
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000459
Family Complement control module/SCR domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005907   Gene: ENSONIG00000004689   Transcript: ENSONIT00000005911
Sequence length 3577
Comment pep:novel scaffold:Orenil1.0:GL831202.1:2148947:2381831:-1 gene:ENSONIG00000004689 transcript:ENSONIT00000005911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSTWEPIINVVVGPVLCVMNKRVMMEVVEVGKAQNCSYTLHNPNGTIESPGYPYGYPNYA
NCTWVIVAAEHNRIQLVFQGFALEEDFDILSVYDGPPSPGNLRTRLTGFQLPPPIVSTGS
RLTLWLLSDYAVSGQGFKAAYEALPSYTCGNPGKLLNGHQQGSTFNIGDKIRYSCSPGHV
LEGHTTLSCLATSAGTAAWDFPLPYCRADDGCGGTLRGQSGVITTPNYPSEYNNNADCTW
TVLAEPGDTIALVFSDFQLEDDYDLLEVSGTEGSSQWFTGPNLPSPIISSKNWLRLHFTS
DGNHKLRGFSAQYQVKKMTELKSRGVKMLPSKDNHHKISVLSQMGVAQGHNMCPDPGIPD
RGKRKGSDFRRGATVHFSCDEGYELQGSKSITCLRVTDSYVGWSDDRPICRAPMCGGLLR
GPSGVITSPNYPVQYDNNANCTWVITATDTSKVIKLTFEDFDLERGYDTLTVGDGEVVGD
QKTIFHVLSGSTTPDLVVSTSHQMWLNFKTDDTSGSLGFKVSYEEIEQGSCGDPGIPAYG
KREGTGFRHGDRLYFECLPAFELVGKKNITCQKNNQWSAKKPSCVFSCFFNFTTPSGVLL
SPNYPQEYGNNMHCVWLIITNPESRINLAFNDLSMEKQFDFLSIKDGGKAESPILGTFSG
DVLPPPITTSAHVARLEFLTDHTYTDRGFNITFTTFRHNECPDPGVPVNGKRFGESLQLG
SSISFLCEDGFVKTHGSLTISCILKDGNVVWDNAVPRCEAPCGGDLKAPSGIILSPGWPE
LYKEALNCEWIIEAPPGYPIKIIFDKFRTEVNYDVLEVRDGRFPSSPLIGSYQGTQVPQF
LISTSNFLYLLFTTDKSHSDIGFRIRYETLQLQSDHCVDPGIPVNGQRHGNDFYVGALVT
FSCDAGYTLSDSEPLECEPNFQWSRPLPSCDALCGGYIQGNAGTILSPGFPDFYPHNLNC
TWIIETSHGKGVQFTFHTFHLESPHDHLLVTENGSFSQPLWRLTGSTLPPPLSAGLFGNY
TAQIRFLSDFSVSYEGFNITFSEYDLEPCEDPGIPPYSTRKGLQYGVGDALIFSCFPGYR
LEGPARVVCLGGRRRVWSSPLPRCVAECGSSVTGMQGVLLSPNYPGYYGNNHECIYSIQT
QPGKGIQLRARDFRLEEDDILKVFDGSSNKARLLGVFTGNDLLDTTLNSTSSSMWLEFIS
NADNTSKGFELHFTSFELVKCEDPGVPQFGYKREDKGHFAGSTVSYSCDPGYTLKGPEVL
TCLRGERRAWDSPLPLCVAECGGTIKDEPSGRVLSPGYPAPYEHNLHCMWTIEAAPGSTI
SLHFLVFHTEEVHDVLRIWDGPQDGGVLLRELSGSALPQDVHSTFNTISLQFTTDFFTSK
QGFALQFSVSTATSCNDPGMPTNGTRGGDSREPGDHVVFQCDPGYILQGANRITCTEING
RFFWQPDPPTCTVIAPCGGNLTGPSGLILSPDYPEPYPHGRECDWTVTVTQDYVISLTFN
QFSLEPSYDFLHIYDGPDSLSALLGSFYGTDVPDRIESSSNTLFLAFRSDASLSSNGFVL
QYTENPRESCFEPGLVRNGTRVGTDLKLGSTVTYHCDSGYTLEGDPTLTCIMGVDGKPSW
NKPKPICIAPCGGQYSGTEGVVLSPGYPGNYSSARTCLYSVVVPKDYVVFSQFAFFQTAL
NDIVEVYDGATQHSRVLSSLSGAHTGESLPLATSNQILIRFTSKGQSSSRGFHLVYQAVP
RTSATQCSSVPEPRNGRRMGNNFAVGAVVRFECSPGYVLEGSSAVECLTVPSALAQWNSS
IPSCIVPCGGNLTQRTGTILSPGFPEPYLNGLNCVWKITVPEGSGIQIQVISFVTEQNWD
SLEVFDGGDNTDTMLGSFSGTTVPALLNSTSNQLYLHFFSDISVSAAGFRLEYKTVSLTN
CPEPVVPMNGIKVGERLQMNNVVSFHCEPGYTLQGNSHITCMPGTVRRWNYPPPLCIAQC
GGIREEMEGMILSPGFPGNYPSNSDCTWRIYLPVGYGAHIQFLNFSTEANHDFLEIRNGP
LETSAVIGRFSGQDVPSSLLTTSHETTIYFHSDHSQNKPGFRFEYQAYELQECPDPEPFR
YGVVVGAGFNVGQSISFECLPGYQLTGHSILTCEHGTTRNWDHPFPRCEVPCGGNITSDN
GTIFSPGYPEEYPSSADCSWLITVAPGFGIKLNFSLLQVHGPHDFITVWDGPQETARKLG
VFTDGEPNDPPSSTSNQVLIRFRSNTEKGGLFRISYQAYRLQYCLPPPIIPNAEILMASK
EFKIGDIVRYRCLPGYQLSGNSILTCRLGTHLEFEGPPPSCDVTCPMNEILTASTGVIMS
QSPGNGFPHFESCSWVVKVEPGYNITFTIEHFQTSRQFDELEIFDGPSRQSPLLITLSGN
YSSPLSITSSSNKVYLHWSFDHTTSHKGFRIRYSAAYCSPPNSPVNGTVHSLTGTKLGST
LRFSCDQGFRLIGQSSATCTRTAQGIYQWNAPVPLCQVMSCGMPVPPVNGSIAGQDFSLG
ARVTYQCNPGFRLSGPITTSVICQESGRWSPIEAPPRCIPVTCPDIGHSAVEHGRWRLIY
GTQNQYDAIMMLTCDPGYYYRGQRVIRCQANSTWNYPNPRPVCDIISCGDLGTPPNGHKI
GTLTVYGATAIFSCNTGYTLVGSRVRECMSNGLWSGTQVQCLAGHCGTPEPIVNGQIIGE
NYNYRGSVVYQCNPGFRLIGVSVRVCEQDHRWSGRTPVCVPITCGHPGNPTFGMTQGTQF
NLNDVVRFICNTGYVLQGAVKSTCQANGQWSNALPRCKIVNCTEPGHVENSIRQVLSSGP
HRYSFQTTVSYRCSPGYYLLGTSSISCQGDGTWDRSLPKCLLVLCDRPSVPPYTQISGDR
RTVGSVIRYSCIGQRSIIGNTTRMCQLDGQWSGSPPHCSGEAAGLCGDPGVPVHGIRLGE
EFTVGSVVRFSCEPGYALKGSPERTCLANGSWLGTQPECHVVSCGNPGTPRNAQILIHDG
LTFSRSITYTCREGYYSTGLLTRHCTVNGTWTGNMPECSVINCGDPGVPANGVRFGNDFT
YNHTVTFQCSPGFTMDADRASSLICTKTRTWNGTKPLCKAIVCGPPPTIPNGQVVGTDFT
WGSSISYSCNQGYQLSLPTVLTCQGNGNWSGEKPQCFPVFCGDPGMPTQGRREDSGFTYL
SSVSFFCDPPLVLVGSSRRYCQYDGTWSGTQPSCIAKIHTTCGDSGTPLFGNQNNSQGYQ
IGSTVFFSCRKGYLLQGSISRTCLPNLTWSGFQPECIAHHCSQPELPAQSDVRAIELPSL
GYTLIYTCQPGFYLAGGSEHRTCRSDGSWSGKPPLCAADIRPSGRGPVVPVQEPSSKHPV
PVGVFAKNSLWRGSYEYLGKKQPAMLSITAFEPFSNRVNGTLIDHSGVELKLAGTYKRED
AQLVLQVHQIRGPVEIFVNKFKMDNWSLDGRVSYISSSNSYVYQGVVTGKGFGQFGLQRL
ESLDPSRDHPGYNFASNSSSVAAAILVPFIAMIIAGFALYLYKHRRRPKVPFNGYVGHEN
TNGRATFENPMYDRNIQPTDIMANETEFTVSTVCTAV
Download sequence
Identical sequences I3JAL7
ENSONIP00000005907 ENSONIP00000005907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]