SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006146 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006146
Domain Number 1 Region: 3950-4321
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.7e-101
Family Regulator of chromosome condensation RCC1 0.0012
Further Details:      
 
Domain Number 2 Region: 4458-4789
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.35e-89
Family Hect, E3 ligase catalytic domain 0.0000399
Further Details:      
 
Domain Number 3 Region: 412-771
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.19e-87
Family Regulator of chromosome condensation RCC1 0.003
Further Details:      
 
Domain Number 4 Region: 2959-3250
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.48e-61
Family Regulator of chromosome condensation RCC1 0.0019
Further Details:      
 
Domain Number 5 Region: 2726-2910
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.17e-32
Family APC10-like 0.0072
Further Details:      
 
Domain Number 6 Region: 2551-2628
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.96e-29
Family CPH domain 0.00058
Further Details:      
 
Domain Number 7 Region: 3201-3326
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 7.85e-29
Family Regulator of chromosome condensation RCC1 0.046
Further Details:      
 
Domain Number 8 Region: 1857-1924
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 3.01e-21
Family Mib/herc2 domain 0.00015
Further Details:      
 
Domain Number 9 Region: 1198-1284
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.00000000000118
Family Cytochrome b5 0.0093
Further Details:      
 
Domain Number 10 Region: 2447-2502
Classification Level Classification E-value
Superfamily UBA-like 0.000062
Family UBA domain 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000006146
Domain Number - Region: 3620-3706
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00335
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006146   Gene: ENSONIG00000004888   Transcript: ENSONIT00000006150
Sequence length 4835
Comment pep:novel scaffold:Orenil1.0:GL831234.1:2506958:2559516:1 gene:ENSONIG00000004888 transcript:ENSONIT00000006150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPSFTLDAQLRFHDKWLKIDLQRAFSPEGLSEMWNEMVKDEEITFNGEESAHPEDCTD
CFGAQKKDEPNDKEKKEEEETSTSVHHSIIETWDWGRQPDEKELKDCLMVLVEDQQKLSA
QMAKSTLSAQRLRQRLVILERYLISLSHSMMEEKYKVRWKTPPSPPLPAADNKSPRPASK
GVEGLARVGSRAALSFAFAFLRRAWRSGDDADLCSELLQESLDALRALPEATLFDEGTVS
SVWLEVVERATKFLRSVVLSDVHGSASIKCNIPLQDQHLALAILLELAVQRGTLSQLLSA
VLLLLRLWESGTREMDNERSTQGTSAPLLPLLQRFQNIHSSKEEPVPEEEAEILTAPLSP
NESFLRYLTLPQDNDLAIDLRQTAVVIMAHLDRLASPCSPPHCNSPTSHKGTLQEVIAWG
LLGWKLYANVNGPIQCKALSSLGVTQIVCSEKGFLILSSSGAVYSQNYKSTTLAPMLIHV
LSSRKIVKLAAHPDGQHYLALSSNGEVFSWGCGDGGRLGHGDTTYLEEPKMIGTFNGKQA
GKHVVHVACGSTYSAAITADGELYTWGRGNYGRLGHGSSEDQTTPMVVTAFKGLKVVDVA
CGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLVEKLQDLDIVKVCCGSQFS
VALTKDGQVYTWGKGDNQRLGHGTDEHVRYPKLLDSLQGKKVVDVAVGSTHCLALTDDGE
VLSWGSNDKLQHFDTLFSNKKQPKALPGLNSKHIVGISCGPGQSFAWSSSSEWSVGKRVP
FVVDVCPMTFEQLDLLLRQVSEGMDGSSDWPPPQEKECMVVATLNLLRLQLHAAISNQVD
PEELGLGLGSVLLNNLKQTVVVLASNAGVLNTVQAAAQAVLQSGWSVLLPTAEERARALS
SLLPNAASGNEMSVSPGRRFMIDLLVSSLMADGGLESALNAAITAEIQDIEAKKEAQKEK
EIDEQEANASTIHRCRTMLDKDLINTGIYESAGKQSLPLVQLVQQLLRNIASQTIARLKD
VARRISNYLEAEHVSKERSASLDLLLRFQRLLVSKLYLGVNGTENVNGYNPELLGVGSLL
KKYIALLCTHIGDILPVATSIASTGCRHFAEVSRVIEGDLTGVLLPELVVSIILLLTIDA
GLMQETGSIPLLAGLLEHLDRFNHLAPGHERDDNEDLAWPGIMGSFFTGQSSKNNEEVSL
IRKADLENHNKDGGFWTVIDGKVYDIKDFQAQSQSLTGNSILAQFAGEDPVVALEAALQF
EDTRESMQAFCVGQYMEPNQETVTTPDLSSLSSPLIDTERNMGLLLGLHASYLAKSTALS
PMEIECAKWLQSSIFSGGLQTSQIHYNYNEEKDEDHCSSLGTSTPDKAKLYSRRITLSDH
AQPFLQAIADNNTQDHTVKDFLCQIERCCKQYHLIAPITFLPEHPVEEVGRLLLCCLLKH
QDLGHVALSLVSQCALGVDQGKQRSLPKSVIDVCRMVYQAKCSLIKTHQDQGRSYKEVCA
PVIERLRFLFNELRPAVSNDLSIVSKLKLLSSQPRWRSITQKLIRDRRKKRVPKKSESAD
IEEPKLENEGTNEEELNVHISPAPADRKSPTDKTAKQDKWQPLLNTVASVQKYRWLKHSV
QGAFSQSSLMATIVDFALKEEPLDVEKMRKCLLKQLERAEVRLEGIDTMLKLASKSFLLP
SVQYAMLCGWQRIIPEGTNIGEPLSDCLKDVDLIPPFNRMLLEVTFGKLYSWAIQNIRNI
LLEASARFKELGVQPVPLQTITNENPAGPSLGTIPQARFLLAMIHMLSLKHGSNSLSLLL
NSGILALTQSILRLIGPSTDSSDEDLSLCAHGGSATVLEESRKEAAPAPLPASGPELAAM
MKIGTRVMRGVDWKWGDQDGPAPGLGRVIGELGEDGWIRVQWDTGSTNSYRMGKEGKYDL
KLAEPPPAAQPPAEDSDTEDDTEGELIEKSSHPTAMMLTSTVNLLKTLSLSAGIHAEVLQ
SDATRTLCGLLRMLVESGANDKSGCHSHRLVSREQHRSWCTLGFIRSIALMPQMCSTLST
SAWIGLLIRIVEGHQSFNAITLQRQILALRLLQAVLPSWDKTERSQDMKFLVEKLFSFLG
SLLSTCSSDLPLLREGSLRRRKSRPQASLTATHSSTLAEEIVAVLRTLHSLSQWNSLIND
YINNQLSSIADVMASCQSEACFLEECFPDLEGPRVGSLMAVLAVIGGIDGRLRLGGQVVH
EEYGEGTVTRITPKGRITVQFHEMRTCRVCLLSHLKTLPAISFSVQNLPFTEPMLAVWAQ
LVSLAGSKLEKQRMKKSLSRGLTADQVDLSLLRCQQLRLYVLKAARALLSHQDKLRQILS
QPAVVDIGPNPSEDPVASPDVGDLSPEGPLPPLILLQQLLSAATQPSPIKAIFDRQEMEA
AALAVCQYLAVESAHPSSPLFEESSSSEATTPITTQHIRPPKQKKQKSSPIPPLPIVGQL
MEMGFPRKNIEFALKSLSGTTGNASGIPGVETLVSWLLDHPDVHVTELSDADTVSDEYSD
EEVLEELEEAEPAFSVPSGAVVTESQIFKKRSDFQSNDDYAVYVRENIQVGMMVKCCRTY
EEVYDGDVGKVIKLDRDGLHDLNVQCDWQNKGGTYWVRYIHIELLGFPPQSSPSHIKIGD
KVRVKPTVTTPKYKWGSVTHRSVGVVKAFSANGKDVIVDFPQQSHWTGLLSEMELVPSVH
PGVRCDGCQMFPINGPRFKCRNCDDFDFCENCFKTRKHNTRHSFGRINEPETGQSPAFCG
RSGKQLKKHHSSQRGMLIDDWSRAVKSLNVSSSVNQASRLIDCSDQCWQSSGSQGKHWIR
LELFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININPTDTTVLLLCDC
TEYHRYIEIAIKQCRSSGIDCKIHGLGIVGRIRAEDEDLATVPFLASDNEEEDDEKTAAG
SLARKKPSGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQVAGGS
KSLFAVTVEGKIYACGEATNGRLGLGLSSGTIPIPRQITALSNYVIKKVAVHSGGRHAMA
LTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAAITSSGELY
SWGLGEYGRLGHGDNTTQLRPKLVKVLLGHRVIQVACGSRDAQTLALTDEGFVFSWGDGD
FGKLGRGGSEGCNVPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHGT
DVHVRKPQMVEGLRGKKIVHVAVGALHCLAVTDTGQVYAWGDNDHGQQGNGTTTVNRKPT
LVQGLEGQKITRVACGSSHSVAWTTVDVTTPSVHEPVLFQTARDSLGASYLGVQSDSDSS
SVSNKLSGQSSVKSNRPSLAKILLSLDGNLAKQQALSHVLSALQIMYARDAVVGALMPAS
MILPAECPSSSPIPPSDSSSSSSVSDEEGPPVPPEAEERVSPNPWQDKKGEVPSSEDAIT
PSSAVTPSACGASSRPFIPVTDDPGAASIIAETMTKTKEDSESQSKVVGPEPQYLDEFTS
LLVPDDTRVMVDVLKLAVSCRSGEKGKEVLSAVLSGMGTAYPQVADMLLELCVTELEDVA
TDSQSGRLSSQPVVVESSHPYTDDTSTSGTVKIPGAEGLRIEFDRQCSTERRHDPLTIMD
GANRIVSVRSGREWSDWSSELRIPGDELKWKFTSDGSVNGWGWRFTVYPIMPAAGPKDLL
SDRCILSCPSMDLVICLLDFRLNFASNRSIVPRLAASLAACAQLSALAAGHRMWALQRLR
KLLTTEFGQSININRLLGDSEGEARSMSFTGSALAALVKGLPEALQRQYEYEDPIVRGGK
QLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCTASRVAVALDKRTSLPRPFLD
EVTKKIRELMADHESMNSLHESHDLFKREHDEQLVQWMNRRPDDWTLSAGGSGTIYGWGH
NHRGQLGGIEGAKVKVPTSTEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRLGI
GGTESVSTPTLLESIQHVFIRKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPC
DRPRVIESLRGVEVVDIAAGGAHSACITASGELFTWGKGRYGRLGHGDSEDQLKPKLVDA
LQGHRVIDVACGSGDAQTLCLTDDDMVWSWGDGDYGKLGRGGSDGCKIPMKIDSLTGLGV
VKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSL
HCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKINRVACGSAHTLAWSTS
KPTNAGKLPAQVPMEYNHLQEIPIMALRNRLVLLHHISELFCPCIPMFDLEGRLGQTGHG
PSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLAGPDG
TKSVFGQMCAKMSSFSPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEMCEELQNALTP
LLIVTPNGRDESGANRDCFLLNPAAKSALHMSMFRFLGVLLGIAIRTGSPLSLNLAEPVW
KQLAGMNLTIADLSEVDKDFIPGLMYIRDNEATPEEFEALTLPFTVPNASGQDIQLSSKY
SHITLENRAEYVRLAINYRLHEFDEQVSAVREGMARVVPVPLLSLFTGYELETMVCGSPD
IPLHLLKSVATYKGVEPTAPLIQWFWDVMESFSNTERSLFLRFVWGRTRLPRTIADFRGR
DFVVQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDDYARI
ALSGEPAADDSSEDSDNEDADSFASDSTQDYLTGH
Download sequence
Identical sequences I3JBA6
ENSONIP00000006146 ENSONIP00000006146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]