SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006163 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006163
Domain Number 1 Region: 461-518
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-20
Family SH3-domain 0.0004
Further Details:      
 
Domain Number 2 Region: 361-440
Classification Level Classification E-value
Superfamily CAD & PB1 domains 9.16e-20
Family PB1 domain 0.0016
Further Details:      
 
Domain Number 3 Region: 8-151
Classification Level Classification E-value
Superfamily TPR-like 2.66e-16
Family Tetratricopeptide repeat (TPR) 0.0000765
Further Details:      
 
Domain Number 4 Region: 239-320
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-16
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006163   Gene: ENSONIG00000004902   Transcript: ENSONIT00000006167
Sequence length 518
Comment pep:novel scaffold:Orenil1.0:GL831349.1:1154172:1158462:1 gene:ENSONIG00000004902 transcript:ENSONIT00000006167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFVDTLRHWDEAVTCVNRQDFSKALEIFLAIQEPNSKIFFDIGCLHLLNQDFDAAEKAF
DCSIRKDEHLAIAFFQRGITFYKKKRYEESLADFQKTFKTLRGNQLIDYKALGLRYILYA
CDVLHNMALVEAQLGRWEKAQEYLMKALDYKTEARFNIIDKALQSILKQKLFKLVEFQSK
EMFKPNKHYVAELEKKDYLGKAKVVASVVPQDEFSGFAPLQPQVEDGPTCPKEPVVLRAL
EGDPHTVLFEFIPETSDELAVVPGNIVFVLQKGADNWAYVVFNERKGLVPYNYLERLEIS
LASNKNKGITPPPSREPPTRPERIQGLTPREATSGNRQRQVCQSKESSFISSHHFQEKQS
TDNSCIVKVHFNFNFVVSVPSGSPYTMLIEKISRKLNLPSSAVTLSLTSEASEQSVISAN
TEMEKLWSRASSGRVTLWCNTKEVREQPSIAMLLLLLQFQEEVHLVALHSYESSNPEDLS
FQQGDKIKLLSKINQDWLEGQCNGNTGIFPASFVEEVP
Download sequence
Identical sequences I3JBC3
ENSONIP00000006163 ENSONIP00000006163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]