SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006171 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006171
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily UBC-like 7.71e-52
Family UBC-related 0.000000152
Further Details:      
 
Domain Number 2 Region: 157-198
Classification Level Classification E-value
Superfamily UBA-like 5.39e-22
Family UBA domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006171   Gene: ENSONIG00000004908   Transcript: ENSONIT00000006175
Sequence length 200
Comment pep:novel scaffold:Orenil1.0:GL831165.1:781961:788604:1 gene:ENSONIG00000004908 transcript:ENSONIT00000006175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELKGEIAGPPDTPYEGGRYQLEI
KIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAA
EPDDPQDAVVANQYKQNPEMFKQTARLWSHVYAGAPVSSPEYTRKIDKLCAMGFEKNAVI
VALSSKSWDVETATELLLSN
Download sequence
Identical sequences A0A1A8AJE4 A0A1A8BCI9 A0A1A8GJ63 A0A1A8J9Z9 A0A1A8M239 A0A1A8R5B3 A0A2I4B6G9 G3Q1G5 H2LHQ9 I3JBD1
XP_003444801.1.78416 XP_004073341.1.28442 XP_004545470.1.88231 XP_005719957.1.53837 XP_005937787.1.24487 XP_006781500.1.46954 XP_008291345.1.38333 XP_010776737.1.77114 XP_012737623.1.37407 XP_013863341.1.33752 XP_015800545.1.37898 XP_017282711.1.84151 XP_018555147.1.34915 XP_022072545.1.10920 ENSORLP00000005523 ENSONIP00000006171 ENSGACP00000023713 ENSGACP00000023713 69293.ENSGACP00000023713 8090.ENSORLP00000005523 ENSORLP00000005523 ENSONIP00000006171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]