SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006255 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006255
Domain Number 1 Region: 88-444
Classification Level Classification E-value
Superfamily ARM repeat 5.38e-103
Family Diap1 N-terninal region-like 0.000000000216
Further Details:      
 
Domain Number 2 Region: 784-1112
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 7.98e-102
Family Formin homology 2 domain (FH2 domain) 0.000000000396
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000006255
Domain Number - Region: 489-563
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0018
Family HBL-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006255   Gene: ENSONIG00000004973   Transcript: ENSONIT00000006259
Sequence length 1219
Comment pep:novel scaffold:Orenil1.0:GL831165.1:1855916:1953344:-1 gene:ENSONIG00000004973 transcript:ENSONIT00000006259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQQTGSSASAAGPKKDKKSKKSYDDGDGKKKFTLKRLIPDELERFTSMRKKDKEKPGPP
PGHRHSSAASYEISAQSGMMNDHSDEYVLELFEQMLVDMNLNEEKQQPLRQKDILIKREM
VSQYLHTSKAGQSQKESSKSAMMYIQELKADYRESQLLSCLESLRVSLNNNPVSWVQNFG
DEGLALLLNLLRKLQEEEYTPIGTKCQHEIIRCLKAFMNNKHGLKSMLESPEGIPLLTRA
INPKVPHMMVDAVKLLSAISILEHPENLHERVLEAITEEAEKQDIERFQPLLTGMRSTSI
ALKGGCMQLINALISRAEELDFRIHIRSELLRLGLRDQLKEVRKIENEELRVQLTVFDEQ
AEDDSEDLKARLDDIRMEMDDVRDIFEILVNTVKDSKAEGHFLSLMQHLLLIRNDYLARP
QYYKLIDECISQIVLHRNGTDPDFKCRNLSFNIEGLIDNMVDKTKVETSEAKASELEKKL
DAELTARHELQVELKKLESDYEQKLQDLSQEKEQLATSKQEREKENQGLQEQLGNLKTQI
EKLSKDLEEAKTKVVTVTVPVPTPVFPPPPPPPPLPGQNAGMPPPPPPPPLPGHANLTVP
QAPQAPPLPGHAGIPPPPPPPPLPGMPGPPPPPPLPGMPGPPPPPPLPGMPGPPPPPPLP
GMGPPPPPPGGPGIPPPLPCPGMASPFGMGGWGAPAPPALPFGLKPKKEYKPEVQLKRAN
WSKIGPEDLSENSFWIKAKEDQFENNELFAKLTLTFSSQTKTSTAKKEQDGGDEKKQAQK
KKVKELKVLDTKSSQNLSIFLGSFRIPYEEIKNAILQVNEKVLTESMVQNLIKQLPGPDQ
LGVLAEMKDEYDDLAESEQFGVVMSGVKRLMPRLQAILFKLQFEEQLNNIKPDVVSVTAA
CEELRKSETFARLLQIILLVGNYMNSGSRNGAAFGFSISYLCKLRDTKSADLKQTLLHFL
ADVCQEQYPDVMSFTDELIHVEKASRVSAETIQKNLEMMGRQIKSLEKDLETFPPPQNDK
DLFAEKMSSFVSHAQEQYEKLDLMHKNMEKQYSDLGDYFVFDPKKISVEELFGDLNNFKN
MFQQAVKENQKRKEAEEKIKRAKLAREKAEKEKEEKLKKNQFPDINAEGDETGIMDGLLE
ALQSGAAFRRKRGPRQAANHRRAGNAVTNILAKELMQEDKPSSSKPSAKKLKSDDKVEPK
LEGAESLEDLLEAAASRSS
Download sequence
Identical sequences I3JBL5
ENSONIP00000006255 ENSONIP00000006255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]