SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006300 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006300
Domain Number 1 Region: 210-600
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 2.35e-32
Family Soluble quinoprotein glucose dehydrogenase 0.0028
Further Details:      
 
Domain Number 2 Region: 881-985
Classification Level Classification E-value
Superfamily SRCR-like 1.05e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006300   Gene: ENSONIG00000005009   Transcript: ENSONIT00000006304
Sequence length 986
Comment pep:novel scaffold:Orenil1.0:GL831147.1:959490:979156:-1 gene:ENSONIG00000005009 transcript:ENSONIT00000006304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIQTCNLVTRCILQHTFSPHHLLPILLLLLRIWWGSCHPQCLDYKPPFEPRQPLAFCKEY
SKFGCCDVEKDEEISGRFYTIMENFDHSGYAACGKYVRSILCQECSPYAAHLYDAEDANT
PMRVLPGLCGDYCSDYWRQCRYTLGLLLEDVGNSQQFANLTATIEEDHRRFCEFLVLKDK
EYCYPSVLTNAELNANLGLLNEDPEGCLELCLQEVANGLRNPVAMIHADDGTHRFFVAEQ
LGYVWVYLANGSRIDRPFLNLTKAVLTSPWAGDERGFLCIALHPRFTTVRKAYVYYSVSV
KKEERIRISEFTVSVHDDNQLDHSSERTILEVVEPASNHNGGQLLFGHDGYLYIFIGDGG
RAGDPFGKFGNSQNKSALLGKVLRVDVDFNDNGAPYSIPSDNPFLGEKEARPEVYAYGVR
NMWRCSIDRGDPVTTEGRGRMFCGDVGQNKYEEIDLIVKGGNYGWRAKEGFSCYDRKLCQ
NSSLDDVLPIFAYPHKLGKSVTGGYIYRGCQMPNLNGLYIFGDFMSGRLMSLRENVITGE
WQYNEICMGRDQTCRFPKLINSYYKYIISFAEDEAGELYFLATGVPSATARGGVIYKIVD
PSRRAPPGKCSIKPSPVKIKGKLIHFHPKEEYVINKKPTTTAVPTTTTTTKPTTTKKKTR
IVIKKPPMPARKKPKPPPTTAATRQTTRKTTLPTTTPALKTTTKSVSTTTVKPRTVQMAA
TTPATTSSTGYRTTSTTADSSRIAKSPTLTTPSTGRHGRPLQYPPSTTSQYFKPQLLTTP
STKLLKQPHMTLISTPYPKAPDHRMTTAWPPYFSQTPLVPSYRLQRPLINTTLLKTQEEK
LWLGEKLESAGEGNQVFKRSRGRGRGQGYKRVREGWRLRVGSVRLVSAEGLPDRGRVEIF
IRGQWGTVCDDLFTIKSGNVVCRQLGFSNALAVMKRAVLGEADDSVKIFLDDVECEGGER
SLLECKRSRVGKHNCSHAEDVGVICG
Download sequence
Identical sequences I3JBR0
XP_005474733.1.78416 XP_005474734.1.78416 XP_019200872.1.78416 ENSONIP00000006300 ENSONIP00000006300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]