SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006312 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006312
Domain Number 1 Region: 2-363
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.48e-92
Family Regulator of chromosome condensation RCC1 0.0025
Further Details:      
 
Domain Number 2 Region: 661-1004
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.7e-88
Family Hect, E3 ligase catalytic domain 0.00000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006312   Gene: ENSONIG00000005018   Transcript: ENSONIT00000006317
Sequence length 1015
Comment pep:novel scaffold:Orenil1.0:GL831147.1:1022238:1031601:-1 gene:ENSONIG00000005018 transcript:ENSONIT00000006317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLFCWGDSSSGQFGPQAAPSPVSWTVPGVITKICCGDRHTLFLNADGNVLSCGHNSQGQ
LGRQKKKNGKIIAQVEALGSVVAMACGQDHCLAVSASGHVFSWGAGEDGQLGLLPTPSSS
HRPSKVPIPLPIPIIQVACGNSHSLALTKGGDVFSWGLNSHGQLGLGKEVPVQHTPVIIC
ALAGVAVTQIAAGGTHSLFLTLADLVYCCGANKCGQLGVNRVDEKGRFNICMVPALRPLS
VSFISCGESHSAVLTKDGKVYTFGDGSQGQLGHSTSANEVKPKLVAGLDGPASQIACGRH
HTLVLGSSGQLWAFGSGAKGQTGNGHNDSCLTPTLVQFPWTTDDTAAMPSDLKIAAGWNT
NFAYSSPAKNSVHKQITGRLDETKLQEWLMMEHGNVEAKREIGSMFLTSSSLVASFTKAN
GFPLEAGDLTVDLEAANRAFDQLFTRQWIKQSVNLVPVCDLLYLSRTALKSPEIILILLT
CPLLQEDSNVMNAVISVAITIAEMSEKTLETLRKWWSSLPPSILMKHIMVFKNALAFMLK
NGLLETHNPGVKFFLEALKLLYKANKAGKSYKVPLSTFYVEEITNAVQPEVDIMLWWQFS
KKEDDVNTPAIFSRYPFLLTLLHKVAIFNIYAATVKDVHRFAHRVALVPDQPHAPDSPPA
PVFQLTLRRTHLVEDTFRQLGAADHCAFQRELLVLFVEDRKETNVNKRDFFLHVFDELMA
PESKMFIYNESQTVAWFPPKPKVEEKTYFLFGVLCGLALYNHNIIHLRFPQALFKKLLRV
KPTLDDMKEFDPVLAESWRIMLEDYTPDVVQTLDTTFTVSWAGETVELDPNEPGKLVTGS
NRKEYVAAFVNYVFNKSVERVFDEFKRGFFKVCNMDVVDFFQPEELQAVMVGQENYDWEV
FKKNTVYEGEYHDEHPNIQVFWEVFESLTAEEKKKFLLFLTGSDRVPFLGMESIKMRVAV
LPDASERHLPESLTCHFLLLLPIYRRYPVERTMRTRLLKAINHNRGFWKKRRTTE
Download sequence
Identical sequences I3JBS2
ENSONIP00000006312 XP_005474732.1.78416 ENSONIP00000006312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]