SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006316 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006316
Domain Number 1 Region: 19-235
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.42e-19
Family Nucleotide and nucleoside kinases 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006316   Gene: ENSONIG00000005021   Transcript: ENSONIT00000006321
Sequence length 253
Comment pep:novel scaffold:Orenil1.0:GL831289.1:1257377:1270495:-1 gene:ENSONIG00000005021 transcript:ENSONIT00000006321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSTQLKEAIADVQDGIRAILLGPPGAGKGTQPARLQRQLPLDNVSISLSLDNVVLLLM
GELFTIMLKTVLDVYISVLTVVLVCHIVCQHFISPSCTFRTHISAVMVPIKNGEMLLDDL
LDKRDEKLDSVIEFSVDDSLLVRRICGRLIHQPSGRSYHEEFNPPKEPMKDDVTGEPLIR
RSDDNEKTLRSRLEAYHRQTSPLVQYYSARGLHTAVDAAQSPNVVFASIVAAFSTAMEMP
ARATACKDQVFFI
Download sequence
Identical sequences I3JBS6
ENSONIP00000006316 ENSONIP00000006316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]