SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006328 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006328
Domain Number 1 Region: 7-204
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.78e-25
Family G proteins 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006328   Gene: ENSONIG00000005032   Transcript: ENSONIT00000006333
Sequence length 238
Comment pep:novel scaffold:Orenil1.0:GL831450.1:505682:567037:-1 gene:ENSONIG00000005032 transcript:ENSONIT00000006333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFPAGPDLRIVMIGKTGVGKSAVGNTILGCEHFRSCPLSASVTEFCQKAWTQWGKRLV
SVVDTPGILDTSKSDEFIKREIVKCVEISSPGPHVFLLVIQIGRFTREEKNSVEALQELF
GPEANKYMIVLFTRGGDLGGISIEQYVRDAEPGLKRIIQSCGNRYHVFDNTSSDRKQVVE
LVKKIDKMMEVNRNTHYTDAMFKEVEEARKKGVTVQQYRFTESLCKRIKLFRIILGKD
Download sequence
Identical sequences I3JBT8
ENSONIP00000006328 ENSONIP00000006328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]