SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006405 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006405
Domain Number 1 Region: 53-160
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-26
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 2 Region: 253-364
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 4.65e-18
Family Platelet-derived growth factor-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006405   Gene: ENSONIG00000005095   Transcript: ENSONIT00000006410
Sequence length 371
Comment pep:novel scaffold:Orenil1.0:GL831147.1:1656815:1709622:1 gene:ENSONIG00000005095 transcript:ENSONIT00000006410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGPVFFHMWTVLILGTLTGVVRAQVSTAKVMRGNNRRDDLYHKEENITVTPQGGVIHSP
RYPNAYPRNLLLSWKLLSPPGSRIHLEFDGHFGLEEAENGMCRYDFVEVEDQSETSTIIW
GRWCGQKAPPSLNSKTNKLKVTFKSDDYFVARPGFKIYYSLLYESPLPASNTNWEAVSVP
MSDSGGGKVSAAVSEQTPFSLDDLDRTIAAFDTVEQLLRSLNPNTWRQDLDSIYTQTHIH
YRSRAYHLAGRHNKVDLNRLHNDVKWYSCTPRNYSVNLREELKTTNAVFFPRCLLVKRCG
GNCGCGTTNWNNGCTCQASKTTLKLHEVLKYAPDPIRYQRHQSPKVRWVIDEIFLSHHEQ
CECACPSQPPR
Download sequence
Identical sequences I3JC15
XP_005474706.1.78416 ENSONIP00000006405 ENSONIP00000006405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]