SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006544 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006544
Domain Number 1 Region: 10-73
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000687
Family PB1 domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006544   Gene: ENSONIG00000005211   Transcript: ENSONIT00000006549
Sequence length 515
Comment pep:novel scaffold:Orenil1.0:GL831165.1:3453593:3456462:-1 gene:ENSONIG00000005211 transcript:ENSONIT00000006549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAQKHVLRVYVERDTALKLTLLERPKSVEELKEIIQERFKPRLDGDFSLHYEDPDFDG
DLCLLVDIQELPEKGTLRVVRPESDTFSTASSDTDILPHVPAIQRQKSWPDEFVVPFGYE
MDHILEEGNRVYEESAKLLKLKRSQKSEILKKMAETIYSFKAYAHKKEVAMAAQALIRAH
PCLRMTTGEDGALGWKRHMGYKLASYRNNLAKAGVAEVAINTGRRSRNNPNNDHPHQNIK
KARKAEVNYITNLPKDQTPASLEKMREQIMHEVEKTERNYLVIGKLMDTTYALRRQEIVG
AVVAPRVRDVVDRWPALLMESQMVAEFHRINNVNLRTQFYKELDRHTPRLITLFRDKAIK
TGKIAEELAKLMRIYDIREQHDVNTRRALVLRALPVYLREDASTLFRTCDQSADGPDLTD
TPVALLTVVTDDTTDSALFSPESICIVVEDEILVNGPTNLADSFLLLFGYIYALDLQYPK
KLELTFTFIQKVVMCLEDNKPLKGRLLTLKNDLFN
Download sequence
Identical sequences I3JCF4
ENSONIP00000006544 ENSONIP00000006544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]