SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006654 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006654
Domain Number 1 Region: 171-310
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.55e-26
Family UBX domain 0.011
Further Details:      
 
Domain Number 2 Region: 6-55
Classification Level Classification E-value
Superfamily UBA-like 1.6e-16
Family UBA domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006654   Gene: ENSONIG00000005291   Transcript: ENSONIT00000006659
Sequence length 311
Comment pep:novel scaffold:Orenil1.0:GL831165.1:4054471:4059927:1 gene:ENSONIG00000005291 transcript:ENSONIT00000006659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELTTLESLLEMGFDRNRAEKAVANTGNQGIEQAMDWLMEHENDPDIDEPYVPPVGNVL
GGEAQSQPSTADSSEGQEGQESFEGIAGGDIGYIETEDGVKRPMTEEEKNEQVKRLEELM
RVKQAERRERERAEEVEREKQRRKQGQELQQIRQKLQDDEMKKIAEQRQREKMEDKLARQ
RVKEKIARDREERAQKFGGGAPSSTAASSQNAQPSPSSPTSQGPPPTKKEYDESRIQVRL
LDGSTITTVFKAQEPLAAVRVYVQMNGNTPEGQDFTLLSPYPRHVYTELDMEKPLKELGL
VPSAVLVVAKK
Download sequence
Identical sequences I3JCR4
ENSONIP00000006654 XP_005467604.1.78416 XP_005467605.1.78416 XP_013126413.1.78416 ENSONIP00000006654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]