SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Oreochromis niloticus 69_1.0 > ENSONIP00000006654

Domain assignment for ENSONIP00000006654 from Oreochromis niloticus 69_1.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSONIP00000006654
Domain Number 1	Region: 171-310
Classification Level	Classification	E-value
Superfamily	Ubiquitin-like	1.55e-26
Family	UBX domain	0.011
Further Details:

Domain Number 2	Region: 6-55
Classification Level	Classification	E-value
Superfamily	UBA-like	1.6e-16
Family	UBA domain	0.00053
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSONIP00000006654 Gene: ENSONIG00000005291 Transcript: ENSONIT00000006659
Sequence length	311
Comment	pep:novel scaffold:Orenil1.0:GL831165.1:4054471:4059927:1 gene:ENSONIG00000005291 transcript:ENSONIT00000006659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MAELTTLESLLEMGFDRNRAEKAVANTGNQGIEQAMDWLMEHENDPDIDEPYVPPVGNVL GGEAQSQPSTADSSEGQEGQESFEGIAGGDIGYIETEDGVKRPMTEEEKNEQVKRLEELM RVKQAERRERERAEEVEREKQRRKQGQELQQIRQKLQDDEMKKIAEQRQREKMEDKLARQ RVKEKIARDREERAQKFGGGAPSSTAASSQNAQPSPSSPTSQGPPPTKKEYDESRIQVRL LDGSTITTVFKAQEPLAAVRVYVQMNGNTPEGQDFTLLSPYPRHVYTELDMEKPLKELGL VPSAVLVVAKK
Download sequence
Identical sequences	I3JCR4 ENSONIP00000006654 XP_005467604.1.78416 XP_005467605.1.78416 XP_013126413.1.78416 ENSONIP00000006654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]