SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006688 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006688
Domain Number 1 Region: 9-171
Classification Level Classification E-value
Superfamily Hook domain 7.72e-38
Family Hook domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000006688
Domain Number - Region: 246-336
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0288
Family HBL-like 0.073
Further Details:      
 
Domain Number - Region: 863-959
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0549
Family HBL-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006688   Gene: ENSONIG00000005318   Transcript: ENSONIT00000006693
Sequence length 1388
Comment pep:novel scaffold:Orenil1.0:GL831165.1:4148546:4201789:1 gene:ENSONIG00000005318 transcript:ENSONIT00000006693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSIKEIIEEFMESALAQWVRHLSFITLSAQTQSARDRYLRLTNGIFLNEVMRVIDPNP
KVERLYNSERDDHMLRVQNFSILNRHLRAFYQEDLQQLILMPLPNVAILGQDPLTEAAVE
ELRRLLLLLLGSAVQCENKETFIQQIQSLDIETQAGIAGCIQQVTQDPRVVLPLQWEELV
ETEGADLQLVFSSMAKQIQSLLAQRDTQLERIAELCREREAQSDSTTGHLGGRNEESSQG
LLLQLADSKAKLRRLKQQLEDKGDQILDYKQEIETMEEQLQKLQKENRSLQGDVRGMRAL
RDELDCARERAARSEQLQTELQSCKHRLRSLERYISTTKYIVFKKNVMQETKTLLEEQLA
DARARCSSLRELERDNLVLRQRIMEVEAERDTERQRVDELLEMNMSLEADLRHSSSGGSV
LAPVVALPQRFLQSELESDEEKPLSVEVGEASTLRLLGAEQENAELRRRLEELQAQQEHM
KGNSDKKDKRKEEGMKMPDRVEEEGEGKKVVRGVQGSESCRGEGEGRVRMMEEKEKRGEV
IGTHREAGVGEEILHVQTGKDEPCNEVIQTNRRGEAEGGQKEREKQEKESEPKKEKTELP
ISSEIQKQSASPDMELLTKRLQEAQEEAERQTNLAQDLRSKLGEQSKKTWEAEQRLVLVE
AELQRLKKAGESLVEARRQIEVLQSEGLVMEEELCRLRSQAELHRMQTTIIATLEGERAT
LERERDMLRSTLDTMRTAQRKSDQLELTTQTLRAELERQGRSLETSRRREEELEAELREA
TLEAESLARARDQALLEASRLEQEKEVCQSELDGQRKEGRQREREAGRLRQQLESTTLAL
EHSNQRACALDAEHRRVCQQLSESKELCAQLQDLEKELSFRLSSMEEGKQQLQEQYAEAQ
AKISALSQDLTREQARSEKLATEVEHLSQKLQRSEAERQSAKDSLHQSQERIESLSQRLK
KTESLQLETRRESAEVKSAPNSNSESTDKQDMSPSDQSPEAAKGCDLSTTRDHFTGEAER
HLSERVIELEKEKAVAAAEHEALLTRLSQSQEACKHLEEQLEALRRNSLSLQDSCTRLQT
LNTQLQVEQASLSSQHAALLARCSESEARCATLEAESKVWAREREESVARMDALRRDHER
MTALQQRQEVELEELVEKHSQLRNNNRSLEAQHRELEGRYKELLDGKTQLEEREREMKTE
REKMETEAQRRLERERELERLKEDNDRLQAHQKEWLASQAELLAQGSVLRAELNASQLER
TRLEGELSALKETHQSLDLSNARLTSQYQLLTQLKGNMEEENRHLAEQNQSLLRENRALL
EQSLERRDQHYSQQREYQEKLSELRREKQKLVEKIMDQYRVLEPSMPSPASKAKKSNWIA
DRMKKLIK
Download sequence
Identical sequences I3JCU8
ENSONIP00000006688 ENSONIP00000006688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]