SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006723 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006723
Domain Number 1 Region: 379-565
Classification Level Classification E-value
Superfamily NTF2-like 3.57e-58
Family NTF2-like 0.000000206
Further Details:      
 
Domain Number 2 Region: 212-367
Classification Level Classification E-value
Superfamily L domain-like 6.12e-33
Family mRNA export factor tap 0.00000214
Further Details:      
 
Domain Number 3 Region: 121-207
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.03e-31
Family Non-canonical RBD domain 0.00026
Further Details:      
 
Domain Number 4 Region: 562-630
Classification Level Classification E-value
Superfamily UBA-like 1.4e-24
Family TAP-C domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006723   Gene: ENSONIG00000005347   Transcript: ENSONIT00000006728
Sequence length 630
Comment pep:novel scaffold:Orenil1.0:GL831165.1:4434844:4445981:1 gene:ENSONIG00000005347 transcript:ENSONIT00000006728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGGHYYNEHDDRTAPQFRNRKGRGPHKGRYDRSRRDRQRGNHSGGFGGPGPRSRLDDT
DGDVTMSDGSQDSSSQNRFNPYGRPFRKGDGRFDRDRRQGKGGGRGGGGGPFRVGDRGGG
GGKNQSGWYKVTIPHGRKYDKKWLLTALQNICSVTYTPVQYHVDHNRVHFYVDDSSVASA
LHKCSHKITDTDGYKVEVHVNKSGPPSFLLSDLKPEHLEHLKQCMAKRFDGSQQALDLNN
IRTDPDLVSQNIEVILNRKTNMEAVIKIIEENIPELTSLNLSNNRIHKLDELAELVTKVP
NLKTLNLSQNELKSDRELDKLKGLKLVELWLTRNPLCDVFKDQASYISAVRQRFPRLLRL
DGHDLPPPIGFDVETPTTIPPCKGSCFGSDEIKAVILRFLQQYYSIYDSGDRQPLLDAYH
DGASLSITTPYSTQNPSRSSLGEYYKDSRNLKRVKDSTIRFRLLKHTRLNVVAFLNELPK
TQHDIASFTIDVNTYTNTLLSFTVSGVFKEVVVDGKSRESTMAFSRVFITVPAGNSGLCI
VNDQLFIRMATTEEIRRAFVAPAPTPSSSPVPTLTAQQQEMLTAFSQKSGMNLEWSQKCL
QDNEWDFSRAAHIFTQLKAEGKIPDVAFIK
Download sequence
Identical sequences I3JCY3
ENSONIP00000006723 XP_005467578.1.78416 ENSONIP00000006723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]