SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006857 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006857
Domain Number 1 Region: 857-1098
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.64e-76
Family Eukaryotic proteases 0.0000488
Further Details:      
 
Domain Number 2 Region: 512-630
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.44e-33
Family Frizzled cysteine-rich domain 0.00024
Further Details:      
 
Domain Number 3 Region: 176-290
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.41e-29
Family Frizzled cysteine-rich domain 0.00063
Further Details:      
 
Domain Number 4 Region: 637-675
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 362-398
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 326-362
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 7 Region: 711-748
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 8 Region: 436-471
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000103
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 402-435
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 766-846
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000445
Family Hepsin, N-terminal domain 0.068
Further Details:      
 
Domain Number 11 Region: 679-709
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000301
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006857   Gene: ENSONIG00000005458   Transcript: ENSONIT00000006862
Sequence length 1105
Comment pep:novel scaffold:Orenil1.0:GL831493.1:51255:78531:-1 gene:ENSONIG00000005458 transcript:ENSONIT00000006862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSARLETCPRVTFSGAGTAATLARGPQARMGGEACPHKLGSTNHLRLLLYILIPTVSLL
AGLLLLVLVLTGIFGSTHLDPSLLPSPKPIADSNPGYHSNSTSDPYPSSSFTVETVTYSP
QNRSDSTPAATTGVPPATSSQALPTQPYTTPPDWLASVTSLSTAWPSSTASAPNTGSCQL
IVEPQCHMLPYNQTWLSSSVAVVKSSEVDMLLRFFSYLSRLSCYRHIMLFGCSLALPECI
AADGTHNRTVVLPCASFCEAAREGCEPVLQMFNASWPDFLRCSQFSNTTSALSPPSSPSS
PSPTGLLTSSACYTPRQIKGKPSVCGGKDHYLCATGICIPQKLVCNGYNDCDDWSDETHC
VCADDEFHCNTGRCLSPALVCDGYDDCGDLSDELNCVCDVAREHRCGDGRCVSRDWLCDG
DHDCLDKSDELNCSCKSQGLLECRNGQCIPSAFRCDGEDDCKDGSDEDNCTVDQSQGGCV
PGQPSCIATTCQPMCAGGNTVCDPRSNSSCTRCEPISLELCMNLPYNLTSFPNYLGHLSQ
RESSVSWESSLFPALVQTGCYQYLMFYACTLLVPKCDPVSLQRVPPCRSLCRSAKEKCES
VLSIVGLQWPEDSDCSQFPEEGGNTTCLLPEAGVDECSPSHFKCRSGRCVLASKRCDGHL
DCDDHSDEDNCGCSERALWECPGSTVCIKASMICDGFPDCPQLVDETNCSVCRDNELSCN
NHQCVHRTLWCDGRKHCSDSSDEWNCVSLSDRSGSVLTVFKTAAEYQVCADEWNDELSEL
TCNQLGLGVPSSVSRVPDQPGVQGRRRWLHVHPEWHQRNGSALQARLEKRSHACHSRQRV
SVLCTREECGLRQAVGLHPHRKKRILGGRVSRRGAWPWQCSLQSGQSGHVCGCVLIARKW
ALTVAHCFEGRESADLWKVVLGINNLDHPGGHSQSRGVRSIIVHPRYNRAVVDYDISIVE
LDFEIEETAFVRPVCLPQPGQLPLPDSYCYITGWGHMGNRMPFKLQEGEVRIISLSQCQS
YFDMKTITPRMLCAGYEAGTVDSCMGDSGGPLVCEESSGRWTLFGLTSWGSVCFSKVLGP
GVYSNVTHFTPWIQQQIYIHTYLTD
Download sequence
Identical sequences I3JDB7
XP_003459153.1.78416 ENSONIP00000006857 ENSONIP00000006857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]