SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007030 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007030
Domain Number 1 Region: 548-622
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.62e-17
Family SAM (sterile alpha motif) domain 0.024
Further Details:      
 
Domain Number 2 Region: 627-700
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.37e-16
Family SAM (sterile alpha motif) domain 0.013
Further Details:      
 
Domain Number 3 Region: 707-784
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000472
Family SAM (sterile alpha motif) domain 0.049
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000007030
Domain Number - Region: 200-263
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00131
Family HBL-like 0.018
Further Details:      
 
Domain Number - Region: 103-191
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00141
Family Myosin rod fragments 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007030   Gene: ENSONIG00000005589   Transcript: ENSONIT00000007035
Sequence length 876
Comment pep:novel scaffold:Orenil1.0:GL831150.1:1163613:1182892:1 gene:ENSONIG00000005589 transcript:ENSONIT00000007035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNASHMLEAALEQMDDIIADVKDYQSPECSQQLTLPPPLDPALKALQLTEALRAVLEG
QGDEEGQDALRKQVSDDTADIILKWLGRVNTINQVNLHSNANSESYQERLSRLEGDKESL
ILQVSVLTDQVEAQGVKISDLQSSLMEHQHKLNSTEEMLQQELLHRASLENQKLSLMGEV
SYLKLKLADMEGKQGHGGERQHKAEGLLKELRILKDKVEHLEDQKLQYEKKLKATKAEIS
SLQQLLHSKNAEIESLHSQLLARPSLTTESAERDQELQRLRSGMKSLAAANDEKDRRIEE
LTLLLNQCRQFREVSSNTRQAPSAVHTLSNGRSLSSSSEEEEQVLMKNGDTSSAKSEDVK
SEVGAKKRIEFIDCDCLHRSEVQTLSSSMNDITNGTAQKDLEKSLSFLFVSTLFIQTGPS
EMRSHTLPVNSSLSEQNGIGDSSSEIQSQRSPAGSEDGDSSQRKPEKGDDSTSSDTSPVH
SGQRAVGSPEYMKNNRSFKRLWGKLRRTQSGGLPATDPDSGQFRRGGLRATAGPRLTRTP
ESFDSARDMNIPFSQWTKEQVCGWLEDYGLGQYVSLSRQWVENGQTLLSATPQDFEKEMA
MKNPLHRKKLQLALRAFTTKVIEKSSELDHIWVTRWLDDIGLPQYKDQFHEARIDGRMIQ
YLTVNDLLTLKVTSQLHHLSIKCAIHVLHANKFNPNCLRRRPVEEKHPPPSEVVQWSNHC
VMEWLRAVDLAEYAPNLRGSGVHGGLIILEPRFSSETLALLLNIPPQKTLLRRHLATAFS
ALVGLQAMQEKREYGNATGHVPLTTTAKVKPKKLGFTQFSHLRKRKPDESADYICPIDSG
ALTVNGVSRLASSAQRGLSPRLDRQAEGEEQVGIKA
Download sequence
Identical sequences I3JDU0
ENSONIP00000007030 ENSONIP00000007030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]