SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007085 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007085
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 2 Region: 118-218
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00015
Further Details:      
 
Domain Number 3 Region: 227-334
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007085   Gene: ENSONIG00000005629   Transcript: ENSONIT00000007090
Sequence length 342
Comment pep:novel scaffold:Orenil1.0:GL832382.1:1952:6274:1 gene:ENSONIG00000005629 transcript:ENSONIT00000007090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PIRLVGSGSTRCSGRVEIYHNNSWGTVCDDGWDINDAEVVCRQLNCGSALEAPHSAHFGA
GTGQIWLDNVTCSGNESSVNECQHSGFGAHNCVHQQEAGVICSGEEPLDIENIAGPNRLA
GSGSTQCSGRVEIYHNNSWGTVCDDGWDLNDAEVVCRELNCGTALQAPHSTHFGAGTGQI
WFNNVTCSGNESSLTECKHSGFGSNICGHGHDAGVVCSVTNKSNIHPSVRLAGSGSTRCS
GRVEVYHNNSWGTVCDNGWDLNDAEVVCRELNCGTALEAPRSAHFGEGRFLQIWFNNVTC
SGYESSLTECPHSGFGINSCGLGQDAGVICSDNSTTQQSKTQ
Download sequence
Identical sequences I3JDZ5
ENSONIP00000007085 ENSONIP00000007085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]