SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007167 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007167
Domain Number 1 Region: 50-335
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.41e-85
Family Regulator of chromosome condensation RCC1 0.012
Further Details:      
 
Domain Number 2 Region: 374-483
Classification Level Classification E-value
Superfamily POZ domain 2.08e-23
Family BTB/POZ domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007167   Gene: ENSONIG00000005688   Transcript: ENSONIT00000007172
Sequence length 548
Comment pep:novel scaffold:Orenil1.0:GL831218.1:1568544:1574745:-1 gene:ENSONIG00000005688 transcript:ENSONIT00000007172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSVFFSLSNQPFFYSILSSMLDVGKWPVFALLPPEELRLIRQACVFGSAANEALYVTVND
EVFALGTNCSGCLGLGDLQSTIEPRRIDVLCGKKIVSLSYGTGPHVVIATADGEVYAWGH
NGYSQLGNGTTNHGLTPALVSTNLLSKRVTEVACGSHHTIALTTDGEVYAWGYNNSGQVG
SGSTANQPTPRRVSSCLQNKVVVNIACGQLCSMAVLDNGEIYGWGYNCNGQLGLGNNGNQ
QTPCRIAALQGVNIVQTQVACGYAHTLALTDEGFVYAWGANSYGQLGTGNKSNQALPTPI
NTDKERIVEVAACHTSHTSAAKTQSGQVLMWGQCRGQAVASPHLTHFSSTDDVFACFATP
AVTWHLLSVDGDDYLTVAQSLKKEFDSPDISDLKFLVDGKCIHVHKALLKIRCEHFRTLL
NETDQDAIEIHQFSYLVYRAFLEYLYTDTINLPPEDAIGLLDLATFYRETRLKRLCQETI
KRGISEENAITLLSAAVKYEARDLEEFCFKFCVNHLTAVTQTQAFADMDHDLLKNFISKA
SRYGAFKN
Download sequence
Identical sequences I3JE76
ENSONIP00000007167 ENSONIP00000007167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]