SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007345 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007345
Domain Number 1 Region: 352-618
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.08e-74
Family Protein kinases, catalytic subunit 0.0000176
Further Details:      
 
Domain Number 2 Region: 41-119
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.73e-28
Family PB1 domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007345   Gene: ENSONIG00000005831   Transcript: ENSONIT00000007350
Sequence length 620
Comment pep:novel scaffold:Orenil1.0:GL831138.1:379107:397620:1 gene:ENSONIG00000005831 transcript:ENSONIT00000007350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDDEEALNSIMKDLAALGRCYTQHNSHKLKNRTLLYKQSQQDLRVKLEHEREKRIILFQR
PLKIKELLQKVTEAFGQQMDMFFMEKELLLPLKTQEDLDQAVLTLGCSSGTNGLLRILLK
TPKNNHVNSRDKQSEMKSSRSLGDLKGSLLKGSERVRKHSTGSLHTGRTSPPPGSVPEEQ
QQIARQGSYTSIHSEGEFIPENPDQSMLDPFGSADNSLSSSCQSIDQALDRRCERVSKQH
AGKTEPENEKWRKSESKLHSRHGKGGTFPRQFQLPNRSKDYGDRRRTLPRSFMPQENLFQ
LVPSSRTRSYNGDSTLQYSDLRSLGKSSQRGTDINGSRRNVQLSYSPRAPVNWRQGKLLG
RGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVNALECEIQLLKNLRHERIVQYYG
CLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTKRYTRQILQGVSYLHSNMIVHRD
IKDPPGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKSVTGTPYWMSPEVINGEGYGR
KADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQPTKPTLPEGVSEACRDFLRQVFVE
EKWRPTADFLLSHPFVQGSF
Download sequence
Identical sequences I3JEQ4
ENSONIP00000007345 ENSONIP00000007345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]