SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007433 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007433
Domain Number 1 Region: 31-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-37
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 
Domain Number 2 Region: 297-416
Classification Level Classification E-value
Superfamily TIMP-like 8.32e-37
Family Netrin-like domain (NTR/C345C module) 0.00032
Further Details:      
 
Domain Number 3 Region: 152-265
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-33
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007433   Gene: ENSONIG00000005906   Transcript: ENSONIT00000007438
Sequence length 416
Comment pep:novel scaffold:Orenil1.0:GL831138.1:1245202:1253067:-1 gene:ENSONIG00000005906 transcript:ENSONIT00000007438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRTCSIFCAWTVLFLTEVCAQSQQRPIFTCGGNITEESGVIGSQGYPGVYPPNTKCVWR
ITVPEGKVVVLSFRFIDLENDNLCRYDYVDVYSGHVNGQRLGRFCGTFKPGALVSTGNKM
LLQMVSDANTAGSGFLAVFSAAHSHERGDQYCGGRLLKPSGTFKTPNWPEKDYPAGVTCS
WHIVAPKNQIIEVKFEKFDVERDNYCRYDHVSIFNGPEINDAKRIGKYCGDSPPAPVLSE
GNQLLIQFLSDLSLTADGFIGHYKFRPKKFPTTTVLPTTTTQPVTTRPIPLKYSVALCRQ
KCKRRGTLESNYCSSDFVITGTVITAVIRGGSMHATVSIINVYKEGNLAIQQAGKTMSTK
IVILCKKCPVIRRGLNYIFMGQVDEEGRGKIAPHHFVMAFKTKNQKGLNVLKNKQC
Download sequence
Identical sequences I3JEZ2
ENSONIP00000007433 ENSONIP00000007433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]