SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007446 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007446
Domain Number 1 Region: 102-219
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-31
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 2 Region: 402-700
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.26e-30
Family Eukaryotic proteases 0.00088
Further Details:      
 
Domain Number 3 Region: 289-335
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000222
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 4 Region: 366-420
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000749
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007446   Gene: ENSONIG00000005915   Transcript: ENSONIT00000007451
Sequence length 700
Comment pep:novel scaffold:Orenil1.0:GL831227.1:2285580:2296746:-1 gene:ENSONIG00000005915 transcript:ENSONIT00000007451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWTQALRGDNCPSSQWNVMCRPCCEYHLIQCRCPSKGTRVGYTVPCCRNVLDECDPCIV
HPGCSLFENCKTCNNGTWRANDDFFVNGKYCTECRQGWSGGDCKTCGGVIQRAQGHIALE
SYPTNARCEWIVQMERGSSIQLRFSLLSLESDHSCRYDYVEVRDGDSVASPVIGRFCGDQ
LPPPIKSSRNFLHILFTSDGYNNFDGFVLTFQEISGRQCEYFKCIHTAAVCHFNNVHPYK
CYSENFFTVSAIKNVACAAPDKPVNGYLLPVYGPKAKLLHGYHRPALDSAGGAETIEFFC
KTSYILSGNHQSTCLSNGSWSSRSPKCVKVCREPSVSALVRQSVVKPHLLSYHGCFKDQR
LQVFSCTKLVIPFSEIPRGFHPVYTSIDYKCASPLYRNKGSSRRTCLKTGRWSGHYVSCS
PVCGKFEAFSRHNLSDTQWPWHAAIYIRSPPDHTGASEESTFWFLACSGALVAQHRVLVV
AQCVVDKNKQQPIQPEHVKVVIGKQYHTPRDVLKSQHHLRVSEIVVHPNFFSSPDSDVAV
LKLKDKAKIRERVLPVCLPKTQGGEVTAQEAYTARWILPNNPRHLGHSATLSLTKLVELT
DVTHCEREFAQGGAHTTAISDNSLCVISKPSSPQSACPIVIPGITTMPAVFSSTRAVLSG
WQLLGLERATSFEKNNCNQPSYTVHTQIANFQDWIEQHVK
Download sequence
Identical sequences I3JF05
ENSONIP00000007446 ENSONIP00000007446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]