SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007515 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000007515
Domain Number - Region: 189-224
Classification Level Classification E-value
Superfamily UBA-like 0.0383
Family UBA domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007515   Gene: ENSONIG00000005966   Transcript: ENSONIT00000007520
Sequence length 226
Comment pep:novel scaffold:Orenil1.0:GL831229.1:96667:99779:-1 gene:ENSONIG00000005966 transcript:ENSONIT00000007520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVWLRKRQTVRAMEVKNPSPKEFKCALSSVLASCNESESEGSVPELEELEPLRPSEPQNL
LLAKSISSADEGLNRPKQSRSEKKARKAMSKLGLKPVHGVTRITIRKSKSILFVISRPDV
FKSPVSDIYIVFGEAKIEDLSQQAHKAAAEKFKVPVTSSPLAPPVPPSLTIKEESEEEEE
EVDEGGLEQRDIELVMAQANVSRAKAVRALKHNKNDIVNAIMELTM
Download sequence
Identical sequences I3JF74
ENSONIP00000007515 ENSONIP00000007515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]