SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007658 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007658
Domain Number 1 Region: 752-828,864-953
Classification Level Classification E-value
Superfamily RUN domain-like 6.93e-36
Family RUN domain 0.002
Further Details:      
 
Domain Number 2 Region: 1113-1286
Classification Level Classification E-value
Superfamily RUN domain-like 2.88e-28
Family RUN domain 0.01
Further Details:      
 
Domain Number 3 Region: 960-1058
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 2.47e-16
Family Lipoxigenase N-terminal domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007658   Gene: ENSONIG00000006080   Transcript: ENSONIT00000007663
Sequence length 1293
Comment pep:novel scaffold:Orenil1.0:GL831150.1:4791778:4827293:1 gene:ENSONIG00000006080 transcript:ENSONIT00000007663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTGFSSGSCRFADYFVICGLDTESGLEPDELSALCQYIEATKFRDGARGKLARGNEGEN
FEQSPLRRTFKSKVLAHYPDNVEWNPFDQDAVGMLCMPKGLSFRTQMDSREPQFHSFIIT
REDGSRTYGFALTFFEEVTSKQICSAMQTLYHMHNAEQYDILHTPTTPQGPEDQRHQHTP
SRPMLHAAPAISRLQRFNSYDISRDTLYVSKCICLITPMAFAQACRKVLQQLHQAVTSPQ
PPPLPLESYIYNILYEVPLPPSGRSLKFSGVYGPVVCQRPSTSELPLFDFAISEMFNLLG
VENVLQLFTCALLEMQILLYSQHYQRLMTVAESITALMFPFQWQHVYVPILPASLLHFLD
APVPYLMGLHSNGQDDRTKLELPQEANLCFVDIDNHFIELPEELPQFPNKLEFIQEISEV
LMSFGVSPEGNIYSSDSQAKYRGFRAADMVSDKRNGNLASPLNSYLLRENETIARLQALV
KRTGVSLDKLEVREDASSNKDGRVQCDEEELKMHQLNIQVREVFANRFTQMFADYEVFVI
QPSHDKESWFTNRDQMQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDSKILCHDDEE
KEHTLRVFDARVDKIRMLNVRTPTLRTSMYQKCTNIEEAEKAIEMRVSKIDHTALHPHLL
DMKIGQGRYEQGFFPRLQSDVLSTGPTSNKWAKRSAPAQWRRRDRQKQHAEHLYLDNDQR
EKYIQEARNLGTTIRQPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKMGREAVE
LGHGEVSITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQDSKEKKNATPG
SLGPPGFIHDTERRKSDGGGSVMPPLKISLIQDMRHIQNISEIKTDVGKARAWVRLSMEK
KLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTIMI
PYHVVVVPSKKLGGSMFTANPWVCVSGELAETGVLQVPRNTLEITFECQNLGKLTTVQMG
HDNTGLYAKWLVECVVVRNEITGHTYKFPCGRWLGKGVDDGSLERILVGELMTPSSENDE
RMCRTPPMQQSPGMMRRFVTISPNSKPKLNTGQIQEGVGEAINGIVKHFHKPEKERGSLT
LLLCGEYGLVWALEQVFQHGFKSPRLFKNVFIWDFLEKAQVYFESAEQREVTPDENWQTR
VRHFCRFMRAINNAPRNIGKDGKFQMLVCLGARDHLLHHWIALLADCPITSQMYEDTALI
KDRSLVNSLIRVLQTLQEFNITLEASLVKGVGI
Download sequence
Identical sequences I3JFL7
XP_003442426.1.78416 ENSONIP00000007658 ENSONIP00000007658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]