SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007669 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007669
Domain Number 1 Region: 798-906
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-24
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 2 Region: 277-397
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-18
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 32-160
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.59e-17
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 239-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000209
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 613-717
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000157
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 159-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000171
Family EGF-type module 0.024
Further Details:      
 
Domain Number 7 Region: 199-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000384
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007669   Gene: ENSONIG00000006087   Transcript: ENSONIT00000007674
Sequence length 982
Comment pep:novel scaffold:Orenil1.0:GL831150.1:4834363:4852877:1 gene:ENSONIG00000006087 transcript:ENSONIT00000007674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVWAARDFCLFLLLLNSRQSAALPEFRDPCAEGSDGCHIDAICQTTQDSYKCTCKAGF
KGDGKQCEDIDECDLEYNGGCVHECNNTPGNYRCTCYDGFHLAHDGHNCLDVDECQFNNG
GCQHTCVNTMGSYECRCKEGFFLSDNQHTCIHRSVEGLNCMNKEHGCAHICKETSKGGVA
CECRPGFELAKNQRDCILTCNHGNGGCQHTCEDTENGSICRCHSRYTLQPDRSSCVETCA
VNNGGCDCTCKDTSTGVRCSCPVGFTLQPDGKTCKDIDECEVNNGGCDHSCKNTIGSFEC
NCRKGFKLLTDERTCQDIDECFFERTCDHTCVNSPGGFQCLCNKGYTMYGLAHCGDINEC
SVNNGGCEHGCENTVGGFECFCRPGYKLHWNKKDCIEAEGLSPAQPPSKPTLNCSKQEGG
DRCFLTCQSQVHISSGTEDSYTVTCGMPLPCLADAQKNNSGSYCLGRETASLARIKTTAT
FKSGTAKCNLKRSQEKLREGLNSARSENVQFSYVSLRCTSSGQRMRSRQGRKAGEEDGSS
ITAEFELDVNREEVTEGCDVNCVRRRSEKRLRKTIRTLRKSINREQFHLHFAGADYDLSR
SPGQLAELPGHCVAGQMLLGRKCVSCSVGTYYDGDQGRCLSCPAGTYQDEEGQMSCEVCP
TPEGREVSKVVGARNISECGGQCSPGQYSHDGFIPCQPCQAGTYQPEVGRTSCFLCGGDL
DTRRSGAVSFQECETKVQCSPGHYYNTSTHRCIRCPTGTYQGDFGQNYCVTCPGNTTTDY
DGSTNIMQCKNRRCGGELGDFTGYIESPNYPGNYPANIECTWIINPPPKRRILIVVPEIY
LPIEDECGDYLVMRKSSLPNSVTTYETCQTYERPIAFTSRSKRLWIQFRSNEGNSAKGFQ
VPYVTYDEDYQELIEDIVRDGRLYASEHHQEILKDKKLMKALFDVLAHPQNFFNYTAQES
REMFPKSFIRFLRSKVLRFLRP
Download sequence
Identical sequences I3JFM8
ENSONIP00000007669 ENSONIP00000007669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]