SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007760 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007760
Domain Number 1 Region: 22-184
Classification Level Classification E-value
Superfamily RUN domain-like 1.57e-43
Family RUN domain 0.0000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007760   Gene: ENSONIG00000006160   Transcript: ENSONIT00000007765
Sequence length 449
Comment pep:novel scaffold:Orenil1.0:GL831229.1:1138611:1161241:1 gene:ENSONIG00000006160 transcript:ENSONIT00000007765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLGVGLHPVRKRGAGRSAVVERKNLLTVCRFSVKTLLDRSCFETIDDSSPEFINFVSI
VEHILSHRLKGQMSWFGYETPRSFWDYIKAACSKVPHNCIRSIESMENVRSSRAKGRAWI
RVVLMEKRLSEYITFALRDFRTSRRFYEDGAIMLGEEAGLLADTLIGLNTIDFSFCLKGE
GLDGSCPAVIDYTPYLKFTQSADSISSDEEEMRTLGSSGSESSTPDKTATAASIFTEQSN
LVSKCKRFEQKYRMALEQKGYLEELVRLREAQLSEAVSQNKALQQSLADTHLSHTLEKEQ
LEYIILELQDQLTVLKNNDLRSRQELTAHLTNQWPSPDAMDANAVALDTLLYRKTTGQWE
EKSFQSLEQLSADMSISQNSLEPSHTLSLEARSANSKWTHQGKEETPSLRGLCGSLTSVA
SYKSLASLRSNECLASPTTEVSSPGFTPS
Download sequence
Identical sequences I3JFW9
XP_003450924.1.78416 ENSONIP00000007760 ENSONIP00000007760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]