SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007831 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000007831
Domain Number - Region: 53-155
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0141
Family Hemolysin E (HlyE, ClyA, SheA) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007831   Gene: ENSONIG00000006216   Transcript: ENSONIT00000007836
Sequence length 221
Comment pep:novel scaffold:Orenil1.0:GL831229.1:1283663:1287920:-1 gene:ENSONIG00000006216 transcript:ENSONIT00000007836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPQFLLPATVVVSVALVGIMKLRKGEHEKYEKQFKFQDVRLRVANDVLGEYQNDKAEKQ
NMLEKANTEHKALEEEVNKLQTGGEKSKGDTDACQADLKAITDEVGAAEAQLKSLKAEQE
KEKTSWTTEEDTLKQQLEKHSLVCQFIKTDIAEARTLCGIKEQPKAEAPKQDQPKAEAPK
QEEPKAEAPKQEEPKAEAPKQEEPKAEAPKQEEAKAEAPKA
Download sequence
Identical sequences I3JG40
ENSONIP00000007831 ENSONIP00000007831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]