SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007908 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007908
Domain Number 1 Region: 545-805
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0000523
Family HBL-like 0.071
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000007908
Domain Number - Region: 1039-1086
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00118
Family Myosin rod fragments 0.0041
Further Details:      
 
Domain Number - Region: 919-1031
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00314
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007908   Gene: ENSONIG00000006277   Transcript: ENSONIT00000007913
Sequence length 1193
Comment pep:novel scaffold:Orenil1.0:GL831229.1:1471167:1522693:-1 gene:ENSONIG00000006277 transcript:ENSONIT00000007913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTPSSGQTTPVDYGVQIRFINDYQNGGGQPAPQPKTKTQTTSKYGVAVRVQGIAGQPYV
VLKDGQKGDSYGVQLKTEYSGYNSLPRNRGKAEPGTEGGYIGGGEQGGLLRRAQSHGSLL
DRDGGPSNEEYQLSRPPGDGKSGSYGNLDGGIGVRGDREQGWHVSDRERGTERNIWHGSY
QAGLNRSLGSVRDSPEPPPQPNELHSNKRQTSVNKLINRFDSVNAGGQQRGLPPAQQHPG
ATSPLTTANPYTSPPSSTHSSLRRSQGNVTKIPGQPANQWASLEPQRPNLTEAQVTPDLL
LDQGQSAELSSEEEQAMKTIYNILRQGSSETDVIVRHKVNLIFQNIQHLKPKQSMREEWM
SEKRKLEEKVVALQTALLEERKDSVSNSDPALKAELESCLDENLQLQEMLDRKKNELNET
QSELTQLRMDRENAEKRVRDMEDQMAEFQDELRRENSNKTDLVSSQAQLMEVLQLKKKLE
ETLRQRERELTALKGALKEEVASHDKEIEAMREQYSADMDKLRSSMEQVSQSHAGIEAER
LRVNASVRSLQQQLEDCRDESSHWMEQFHSTRDELRTTKQELLQTRLEKEEFEEELKELQ
DKMTSMKQQTPDPNHTQTLSQELQQCKADLQKGKSEVEKMRVEFDKKVMEVISLKKSHQN
QEAELKYEIDRLKGQLQKAKEDFTKAQEKNKRLPDPATISELEQKLNEAQSEVTQLKKKL
SLTEEELDTSKTQLSRAHLDINSFQDAQQEQEEATARLKEKISRLEAQLQSNATESSEAE
LALHTEVRGLRSELDEAKRKASRLSQEHRELSQRLEDTEKDKEALKQTISQLEDTKRQQE
RALEKVNKDYDSLNVSLREETQALRVQLEEQKERARKEMQEVQRHENDAHSELEKSKMNI
RKLEEEISRQKKELLLACEERDNHQLDKELLANRLRHLEGELEASKNSHNEKTREIRILE
DKLKRLELEVEEERSSVDMLTDRVARSRDQIDQLRSELMQERSSKQDLELDKNAMERHLK
ELRSRVVDMEGQSRSSVGVSQLESKIQELEDRLRSEEREKNAVLATQRRLERKLKDLNMT
LDEERQTHTEQRDQLALRVKALKRQVDEGETELERLDGMRRKAQRDLEEQMELKEALQTR
VTALETELKRKTQAAIRPALDSSALSSDDDDSLYDSSTITSILTETNLQTSSC
Download sequence
Identical sequences I3JGB7
XP_013130282.1.78416 ENSONIP00000007908 ENSONIP00000007908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]