SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007929 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000007929
Domain Number - Region: 186-279
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0246
Family Hemolysin E (HlyE, ClyA, SheA) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007929   Gene: ENSONIG00000006291   Transcript: ENSONIT00000007934
Sequence length 723
Comment pep:novel scaffold:Orenil1.0:GL831229.1:1544516:1549504:-1 gene:ENSONIG00000006291 transcript:ENSONIT00000007934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTDNPIPSSLEVSSNLNHGSDEVSQAGGLPEGPAQSSSDPDSYSDSYTHVAPSPDEPPLL
PVQSVCRWKERSICEMGRSYNKKGTNSEVSRERTEKAGVEGESELRKRRSLLASLEQIGR
REEEEEVEEFQLPQREDDSGFSVNKCILGALILLGLGTIFFSESDYGPRDLKDAELPGKR
EWLNPEAHSSPLDAENSDLLNKLAKGNEQISVLQAQLQAQNEELKVAQGQAAEGAKERLR
WEAVEKENSRLKTEMASLPVLQKENERMKKELESFPALQKELETLRSTVTELKLSSEDSK
QETAESTGRQTKHPRDDPKQKKKDVKRDRYDMGEQKERKKSVGMEGEKKDRKDGGKKEWK
KEKHEQGMADRENDKEGRQKRHSEGGKQWKEKDWKKEKTSRGDEGKPWKDREGKRERTEK
REKKEQNEDVDRKKPKHKEWKEKGGKAGKEKDERKRWEGSKNHGKDGSREDDRKRWNEYE
RKSQNGKHDKEWKSNNKKWEQSKQEQSKERDGRKEKKHNEDWKKDKSQFQKSKDVHKVKN
NHGKKEEHQYGDQKQPHHTHRKPSMGQPEYWVQQRERLQHSPKPPQECDSVESCAKAEQL
LPVHLPEFEAILQTYLSKAEQAGVDNSKREELKKLATEFFKDGVFVHDQMSFQDFVEDLS
DILEDMVEGDEDGEQDSAIEDEMEEFEREVMKKFSLPGAGEKEKRIKGDWRKRTHMHTLN
ALS
Download sequence
Identical sequences I3JGD8
ENSONIP00000007929 ENSONIP00000007929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]